This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-MEF2C Antibody Picoband™
catalog :
A01131-1
quantity :
100µg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, flow cytometry, immunohistochemistry - paraffin section
product information
SKU :
A01131-1
Product Name :
Anti-MEF2C Antibody Picoband™
Size :
100µg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
Flow Cytometry, IHC-P, WB
Application Details :
Western blot, 0.25-0.5µg/ml, Human.
Immunohistochemistry (Paraffin-embedded Section), 2-5µg/ml, Human, Mouse, Rat.
Flow Cytometry, 1-3μg/1x10^6 cells, Human.
Description :
Boster Bio Anti-MEF2C Antibody Picoband™ catalog # A01131-1. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
MEF2C
Uniprot ID :
Q06413
Immunogen :
A synthetic peptide corresponding to a sequence of human MEF2C (DREDHRNE FHSPIGLTRPSPDERESPSVKRMRLSEGWAT).
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
myocyte enhancer factor 2C
Synonyms :
Myocyte-specific enhancer factor 2C ; Myocyte enhancer factor 2C
Protein Function :
Transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle- specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. Plays an essential role in hippocampal-dependent learning and memory by suppressing the number of excitatory synapses and thus regulating basal and evoked synaptic transmission. Crucial for normal neuronal development, distribution, and electrical activity in the neocortex. Necessary for proper development of megakaryocytes and platelets and for bone marrow B-lymphopoiesis. Required for B-cell survival and proliferation in response to BCR stimulation, efficient IgG1 antibody responses to T-cell-dependent antigens and for normal induction of germinal center B-cells. May also be involved in neurogenesis and in the development of cortical architecture (By similarity). Isoform 3 and isoform 4, which lack the repressor domain, are more active than isoform 1 and isoform 2.
Subcellular Localization :
Nucleus.
Tissue Specificity :
Expressed in brain and skeletal muscle.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Background :
MEF2C (myocyte enhancer factor 2C), also called MADS box transcription enhancer factor 2, polypeptide C, is a protein that in humans is encoded by the MEF2C gene. MEF2C is a transcription factor in the Mef2 family. MEF2C, however, is induced late during myogenic differentiation and has a strict tissue-specific pattern of expression not seen in MEF2A or MEF2B. By fluorescence in situ hybridization, the human MEF2C is mapped to chromosome 5q14, a region with homology of synteny to the mouse location.MEF2C may be involved with maintenance of the differentiated state. Both MEF2A and Mef2c programmed similar profiles of gene expression in the heart that included genes involved in extracellular matrix remodeling, ion handling, and metabolism. NCOA2 mediates the coactivation of MEF2C-dependent transcription through interaction with the MADS box domain of MEF2C.
Research Category :
Calcium Signaling, Calmodulin Pathway, Cardiogenesis, Cardiovascular, Developmental Families, Domain Families, Epigenetics and Nuclear Signaling, Hypertrophy, Mesenchymal Stem Cells, Neurogenesis, Neurology Process, Neuroscience, Signal Transduction, Signaling Pathway, Stem Cells, Transcription, Transcription Factors, Transcription Factors/Regulators
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments