antibody

Anti-TORC2/CRTC2 Antibody Picoband™

A01118-1

100µg/vial

polyclonal

domestic rabbit

nonconjugated

human, mouse, rat

Anti-TORC2/CRTC2 Antibody Picoband™

100µg/vial

Polyclonal

Rabbit

Human, Mouse, Rat

WB

Western blot, 0.1-0.5µg/ml.

Boster Bio Anti-TORC2/CRTC2 Antibody Picoband™ catalog # A01118-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

CRTC2

Q53ET0

(EKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLAY
TR).
A synthetic peptide corresponding to a sequence of human TORC2

Lyophilized

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

No cross reactivity with other proteins.

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

CREB regulated transcription coactivator 2

CREB-regulated transcription coactivator 2; Transducer of regulated cAMP response element-binding protein 2; TORC-2; Transducer of CREB protein 2; CRTC2; TORC2

Transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. Acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. Enhances the interaction of CREB1 with TAF4. Regulates gluconeogenesis as a component of the LKB1/AMPK/TORC2 signaling pathway. Regulates the expression of specific genes such as the steroidogenic gene, StAR. Potent coactivator of PPARGC1A and inducer of mitochondrial biogenesis in muscle cells. Also coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR).

Cytoplasm

Most abundantly expressed in the thymus. Present in both B and T-lymphocytes. Highly expressed in HEK293T cells and in insulinomas. High levels also in spleen, ovary, muscle and lung, with highest levels in muscle. Lower levels found in brain, colon, heart, kidney, prostate, small intestine and stomach. Weak expression in liver and pancreas.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

CREB regulated transcription coactivator 2, also known as CRTC2, is a protein which in humans is encoded by the CRTC2 gene. This gene encodes a member of the transducers of regulated cAMP response element-binding protein activity family of transcription coactivators. These proteins promote the transcription of genes targeted by the cAMP response element-binding protein, and therefore play an important role in many cellular processes. Under basal conditions the encoded protein is phosphorylated by AMP-activated protein kinase or the salt-inducible kinases and is sequestered in the cytoplasm. Upon activation by elevated cAMP or calcium, the encoded protein translocates to the nucleus and increases target gene expression. Single nucleotide polymorphisms in this gene may increase the risk of type 2 diabetes. A pseudogene of this gene is located on the long arm of chromosome 5.

Cancer, Co-Activators/Co-Repressors, Energy Metabolism, Energy Transfer Pathways, Epigenetics and Nuclear Signaling, Metabolic Signaling Pathways, Metabolism, Neurology Process, Neuroscience, Nuclear Hormone Receptors, Nuclear Receptors, Nuclear Signaling, Nuclear Signaling Pathways, Pathways And Processes, Signal Transduction, Signaling Pathway