Anti-MST1 Antibody Picoband™ | Boster A01069-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-MST1 Antibody Picoband™

catalog :

A01069-1

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

SKU :

A01069-1

Product Name :

Anti-MST1 Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml.

Description :

Boster Bio Anti-MST1 Antibody Picoband™ catalog # A01069-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

MST1

Uniprot ID :

P26927

Immunogen :

A synthetic peptide corresponding to a sequence of human MST1 (QRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEE).

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

macrophage stimulating 1

Synonyms :

Hepatocyte growth factor-like protein; Macrophage stimulatory protein; Macrophage-stimulating protein; MSP; Hepatocyte growth factor-like protein alpha chain; Hepatocyte growth factor-like protein beta chain; MST1; D3F15S2; DNF15S2; HGFL

Subcellular Localization :

Secreted.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

Macrophage-stimulating protein (MSP), also known as HLP, HGFL, or HGFLP, is a protein that in humans is encoded by the MST1 gene. The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The receptor for this protein is RON tyrosine kinase, which upon activation stimulates ciliary motility of ciliated epithelial lung cells. This protein is secreted and cleaved to form an alpha chain and a beta chain bridged by disulfide bonds.

Research Category :

Cancer, Immunology, Innate Immunity, Macrophage / Inflamm., Tumor Biomarkers