Anti-Myelin PLP/PLP1 Picoband Antibody | Boster A01056-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Myelin PLP/PLP1 Picoband Antibody

catalog :

A01056-1

quantity :

100 ug/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

sku :

A01056-1

status :

Enabled

name :

Anti-Myelin PLP/PLP1 Picoband Antibody

category name :

Primary Antibodies, Polyclonal Antibodies

gene name :

PLP1

price various sizes :

30ug sample size / $99 100ug / $240 100ug+Free HRP Secondary BA1054 / $240 100ug+Free Biotin Secondary BA1003 / $240

clonality :

Polyclonal

concentration :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

conjugate :

contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

description :

Polyclonal antibody for MYELIN PLP/PLP1 detection. Host: Rabbit.Size: 100ug/vial. Tested applications: WB. Reactive species: Human. MYELIN PLP/PLP1 information: Molecular Weight: 30077 MW; Subcellular Localization: Cell membrane ; Multi-pass membrane protein . Myelin membrane . Colocalizes with SIRT2 in internodal regions, at paranodal axoglial junction and Schmidt-Lanterman incisures of myelin sheat.

short description :

Rabbit IgG polyclonal antibody for Myelin proteolipid protein(PLP1) detection. Tested with WB in Human;Mouse;Rat.

size :

100 ug/vial

sample size available :

30ug for $99, contact us for details

uniprot id :

P60201

host :

Rabbit

immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human Myelin PLP (37-70aa HEALTGTEKLIETYFSKNYQDYEYLINVIHAFQY), identical to the related mouse and rat sequences.

form :

Lyophilized

purification :

Immunogen affinity purified.

storage :

At -20 C for one year. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for a longer time.Avoid repeated freezing and thawing.

cross reactivity :

No cross reactivity with other proteins.

reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

application details :

Western blot, 0.1-0.5ug/ml, Human, Mouse, Rat.

applications :

reactivity :

Human, Mouse, Rat

image labels :

Western blot analysis of Myelin PLP expression in rat brain extract (lane 1), mouse brain extract (lane 2) and SHG-44 whole cell lysates (lane 3). Myelin PLP at 34KD was detected using rabbit anti- Myelin PLP Antigen Affinity purified polyclonal antibody (Catalog # A01056-1) at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method (Catalog # EK1002).

background :

Proteolipid protein 1 (PLP1) is a form of myelin proteolipid protein (PLP). This gene is mapped to Xq22.2. And this gene encodes a transmembrane proteolipid protein that is the predominant component of myelin. The encoded protein may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively splicing results in multiple transcript variants, including the DM20 splice variant.

competitor equivalent skus :

sc 18528 sc 58571 sc 98781 sc 23570 sc 18529 sc 48327 sc 48326 sc 48325 sc 48324

research category :

Cell Adhesion Proteins, Cell Type Marker, Cell Type Markers, Membrane Proteins, Neuroscience, Tags & Cell Markers

synonyms :

Myelin proteolipid protein;PLP;Lipophilin;PLP1;PLP;

gene full name :

Myelin proteolipid protein

molecular weight :

30077 MW

protein function :

This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.

subcellular localization :

Cell membrane ; Multi-pass membrane protein . Myelin membrane . Colocalizes with SIRT2 in internodal regions, at paranodal axoglial junction and Schmidt-Lanterman incisures of myelin sheat.

protein name :

Myelin proteolipid protein

recommended detection systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

last modified :

1/28/19 19:39