antibody

Anti-Human DC-SIGN DyLight® 550 conjugated CD209 Antibody

A01025-Dyl550

50 ug/vial

polyclonal

domestic rabbit

DyLight 550

Anti-Human DC-SIGN DyLight® 550 conjugated CD209 Antibody

50 ug/vial

Polyclonal

Rabbit

DyLight®550

Human

Flow Cytometry

Flow Cytometry, 1-3μg/1x10^6 cells

Boster Bio Anti-Human DC-SIGN DyLight® 550 conjugated CD209 Antibody catalog # A01025-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.

0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.

CD209

Q9NNX6

A synthetic peptide corresponding to a sequence of human DC-SIGN (MSDSKEPRLQQLGLLEEEQLRGLGFRQTRGYKSLA).

Liquid

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

No cross reactivity with other proteins.

At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.

CD209 molecule

CD209 antigen; C-type lectin domain family 4 member L; Dendritic cell-specific ICAM-3-grabbing non-integrin 1; DC-SIGN; DC-SIGN1; CD209; CD209; CLEC4L

Pathogen-recognition receptor expressed on the surface of immature dendritic cells (DCs) and involved in initiation of primary immune response. Thought to mediate the endocytosis of pathogens which are subsequently degraded in lysosomal compartments. The receptor returns to the cell membrane surface and the pathogen-derived antigens are presented to resting T-cells via MHC class II proteins to initiate the adaptive immune response.

Isoform 1: Cell membrane ; Single-pass type II membrane protein.

Predominantly expressed in dendritic cells and in DC-residing tissues. Also found in placental macrophages, endothelial cells of placental vascular channels, peripheral blood mononuclear cells, and THP-1 monocytes.

DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin) also known as CD209 (Cluster of Differentiation 209) is a protein which in humans is encoded by the CD209 gene. This gene encodes a transmembrane receptor and is often referred to as DC-SIGN because of its expression on the surface of dendritic cells and macrophages. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are rare but have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene. DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants.

Adaptive Immunity, Antiviral Signaling, Cell Adhesion, Cytoskeleton / Ecm, Host Virus Interaction, Immune System Diseases, Immunology, Interspecies Interaction, Microbiology, Signal Transduction, T Cells