This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-RanBP2 Antibody Picoband™
catalog :
A00981
quantity :
100 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
SKU :
A00981
Product Name :
Anti-RanBP2 Antibody Picoband™
Size :
100 ug/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
WB
Application Details :
Western blot, 0.1-0.5µg/ml, Mouse, Rat, Human.
Application Notes :
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-RanBP2 Antibody Picoband™ catalog # A00981. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
RANBP2
Uniprot ID :
P49792
Immunogen :
different from the related mouse sequence by nine amino acids.
EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAA
E),
A synthetic peptide corresponding to a sequence at the C-terminus of human RanBP2 (3018-3057aa
EQLAVRFKTKEVADCFKKTFEECQQNLMKLQKGHVSLAA
E),
A synthetic peptide corresponding to a sequence at the C-terminus of human RanBP2 (3018-3057aa
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
E3 SUMO-protein ligase RanBP2
Synonyms :
E3 SUMO-protein ligase RanBP2; 6.3.2.-; 358 kDa nucleoporin; Nuclear pore complex protein Nup358; Nucleoporin Nup358; Ran-binding protein 2; RanBP2; p270; RANBP2; NUP358;
Molecular Weight :
358199 MW
Protein Function :
E3 SUMO-protein ligase which facilitates SUMO1 and SUMO2 conjugation by UBE2I. Involved in transport factor (Ran-GTP, karyopherin)-mediated protein import via the F-G repeat-containing domain which acts as a docking site for substrates. Binds single- stranded RNA (in vitro). May bind DNA. Component of the nuclear export pathway. Specific docking site for the nuclear export factor exportin-1. Sumoylates PML at 'Lys-490' which is essential for the proper assembly of PML-NB.
Subcellular Localization :
Nucleus. Nucleus membrane. Nucleus, nuclear pore complex. Detected in diffuse and discrete intranuclear foci (PubMed:11839768). Cytoplasmic filaments (PubMed:7775481).
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
RAN binding protein 2 (RANBP2) is protein which in humans is encoded by the RANBP2 gene. This gene encodes a very large RAN-binding protein that immunolocalizes to the nuclear pore complex. The protein is a giant scaffold and mosaic cyclophilin-related nucleoporin implicated in the Ran-GTPase cycle. And the encoded protein directly interacts with the E2 enzyme UBC9 and strongly enhances SUMO1 transfer from UBC9 to the SUMO1 target SP100. These findings place sumoylation at the cytoplasmic filaments of the nuclear pore complex and suggest that, for some substrates, modification and nuclear import are linked events. This gene is partially duplicated in a gene cluster that lies in a hot spot for recombination on chromosome 2q.
Research Category :
Cell Biology, Cell Cycle, Cell Division, DNA / RNA, Epigenetics and Nuclear Signaling, Nuclear Import / Export, Proteasome / Ubiquitin, Protein Trafficking, Proteolysis / Ubiquitin, RNA Processing, Signal Transduction, Spindle, Ubiquitin & Ubiquitin Like Modifiers
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments