Anti-PAX8 Antibody Picoband™ | Boster A00943-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-PAX8 Antibody Picoband™

catalog :

A00943-1

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

SKU :

A00943-1

Product Name :

Anti-PAX8 Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml.

Description :

Boster Bio Anti-PAX8 Antibody Picoband™ catalog # A00943-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

PAX8

Uniprot ID :

Q06710

Immunogen :

(RKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKG
EQ).
A synthetic peptide corresponding to a sequence of human PAX8

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

paired box 8

Synonyms :

Paired box protein Pax-8; PAX8

Protein Function :

Transcription factor for the thyroid-specific expression of the genes exclusively expressed in the thyroid cell type, maintaining the functional differentiation of such cells.

Subcellular Localization :

Nucleus.

Tissue Specificity :

Expressed in the excretory system, thyroid gland and Wilms tumors.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

Paired box gene 8, also known as PAX8, is a protein which in humans is encoded by the PAX8 gene. This gene encodes a member of the paired box (PAX) family of transcription factors. Members of this gene family typically encode proteins that contain a paired box domain, an octapeptide, and a paired-type homeodomain. This nuclear protein is involved in thyroid follicular cell development and expression of thyroid-specific genes. Mutations in this gene have been associated with thyroid dysgenesis, thyroid follicular carcinomas and atypical follicular thyroid adenomas. Alternatively spliced transcript variants encoding different isoforms have been described.

Research Category :

Auditory System, Developmental Families, Domain Families, Epigenetics and Nuclear Signaling, Neuroscience, Sensory System, Transcription