This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-TGF beta 2/TGFB2 Antibody Picoband™
catalog :
A00892-1
quantity :
100µg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry - paraffin section
product information
SKU :
A00892-1
Product Name :
Anti-TGF beta 2/TGFB2 Antibody Picoband™
Size :
100µg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
IHC-P, WB
Application Details :
Western blot, 0.1-0.5µg/ml.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml
Description :
Boster Bio Anti-TGF beta 2/TGFB2 Antibody Picoband™ catalog # A00892-1. Tested in IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
TGFB2
Uniprot ID :
P61812
Immunogen :
A synthetic peptide corresponding to a sequence of human TGF beta 2 (ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPK).
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
transforming growth factor beta 2
Synonyms :
Transforming growth factor beta-2; TGF-beta-2; BSC-1 cell growth inhibitor; Cetermin; Glioblastoma-derived T-cell suppressor factor; G-TSF; Polyergin; Latency-associated peptide; LAP; TGFB2
Protein Function :
TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.
Subcellular Localization :
Secreted.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Background :
This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate a latency-associated peptide (LAP) and a mature peptide, and is found in either a latent form composed of a mature peptide homodimer, a LAP homodimer, and a latent TGF-beta binding protein, or in an active form consisting solely of the mature peptide homodimer. The mature peptide may also form heterodimers with other TGF-beta family members. Disruption of the TGF-beta/SMAD pathway has been implicated in a variety of human cancers. A chromosomal translocation that includes this gene is associated with Peters' anomaly, a congenital defect of the anterior chamber of the eye. Mutations in this gene may be associated with Loeys-Dietz syndrome. This gene encodes multiple isoforms that may undergo similar proteolytic processing.
Research Category :
Angiogenesis, Cancer, Cancer Metabolism, Cardiovascular, Developmental Biology, Growth Factors, Growth Factors/Hormones, Invasion/Microenvironment, Metabolism, Metabolism Processes, Organogenesis, Pathways And Processes, Response To Hypoxia, Secreted, Signal Transduction, Signaling Pathways, Stem Cells, Tgf Beta
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments