This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-L1CAM Antibody Picoband™
catalog :
A00729-1
quantity :
100µg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
immunohistochemistry
product information
SKU :
A00729-1
Product Name :
Anti-L1CAM Antibody Picoband™
Size :
100µg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
IHC
Application Details :
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml.
Description :
Boster Bio Anti-L1CAM Antibody Picoband™ catalog # A00729-1. Tested in IHC applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
L1CAM
Uniprot ID :
P32004
Immunogen :
A synthetic peptide corresponding to a sequence of human L1CAM (NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW).
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
L1 cell adhesion molecule
Synonyms :
Neural cell adhesion molecule L1; N-CAM-L1; NCAM-L1; CD171; L1CAM; CAML1; MIC5
Protein Function :
Neural cell adhesion molecule involved in the dynamics of cell adhesion and in the generation of transmembrane signals at tyrosine kinase receptors. During brain development, critical in multiple processes, including neuronal migration, axonal growth and fasciculation, and synaptogenesis. In the mature brain, plays a role in the dynamics of neuronal structure and function, including synaptic plasticity.
Subcellular Localization :
Cell membrane
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
L1, also known as L1CAM, is a transmembrane protein member of the L1 protein family, encoded by the L1CAM gene. The protein encoded by this gene is an axonal glycoprotein belonging to the immunoglobulin supergene family. The ectodomain, consisting of several immunoglobulin-like domains and fibronectin-like repeats (type III), is linked via a single transmembrane sequence to a conserved cytoplasmic domain. This cell adhesion molecule plays an important role in nervous system development, including neuronal migration and differentiation. Mutations in the gene cause X-linked neurological syndromes known as CRASH (corpus callosum hypoplasia, retardation, aphasia, spastic paraplegia and hydrocephalus). Alternative splicing of this gene results in multiple transcript variants, some of which include an alternate exon that is considered to be specific to neurons.
Research Category :
Axonal Guidance Proteins, Cell Adhesion, Cell Adhesion Molecules, Cytoskeleton / Ecm, Growth And Development, Neurogenesis, Neurology Process, Neuroscience, Signal Transduction
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits