Anti-ATTY/TAT Antibody Picoband™ | Boster A00622 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-ATTY/TAT Antibody Picoband™

catalog :

A00622

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

SKU :

A00622

Product Name :

Anti-ATTY/TAT Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-ATTY/TAT Antibody Picoband™ catalog # A00622. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

TAT

Uniprot ID :

P17735

Immunogen :

different from the related mouse and rat sequences by two amino acids.
FSLYKTLAESMGIEVKLYNLLPEKSWEIDLKQLEYLIDE
K),
A synthetic peptide corresponding to a sequence in the middle region of human ATTY (169-208aa

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Tyrosine aminotransferase

Synonyms :

Tyrosine aminotransferase; TAT; 2.6.1.5; L-tyrosine:2-oxoglutarate aminotransferase; TAT;

Protein Name :

Tyrosine aminotransferase

Molecular Weight :

50399 MW

Protein Function :

Transaminase involved in tyrosine breakdown. Converts tyrosine to p-hydroxyphenylpyruvate. Can catalyze the reverse reaction, using glutamic acid, with 2-oxoglutarate as cosubstrate (in vitro). Has much lower affinity and transaminase activity towards phenylalanine.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

This nuclear gene encodes a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate. Mutations in this gene cause tyrosinemia (type II, Richner-Hanhart syndrome), a disorder accompanied by major skin and corneal lesions, with possible mental retardation. A regulator gene for tyrosine aminotransferase is X-linked.

Research Category :

Antiviral Signaling, ChIP’ing Antibodies, Epigenetics and Nuclear Signaling, Immune System Diseases, Immunology, Microbiology