Anti-Cytochrome P450 17A1/CYP17A1 Antibody Picoband™ | Boster A00615-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Cytochrome P450 17A1/CYP17A1 Antibody Picoband™

catalog :

A00615-1

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

product information

SKU :

A00615-1

Product Name :

Anti-Cytochrome P450 17A1/CYP17A1 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human

Application(s) :

Flow Cytometry, IHC-P, IHC-F, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat. Immunohistochemistry (Frozen Section), 0.5-1µg/ml, Human. Immunocytochemistry, 0.5-1µg/ml, Human. Flow Cytometry, 1-3μg/1x10^6 cells, Human

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Cytochrome P450 17A1/CYP17A1 Antibody Picoband™ catalog # A00615-1. Tested in Flow Cytometry, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

CYP17A1

Uniprot ID :

P05093

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human CYP17A1 (383-419aa EFAVDKGTEVIINLWALHHNEKEWHQPDQFMPERFLN), different from the related mouse and rat sequences by ten amino acids.

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Steroid 17-alpha-hydroxylase/17,20 lyase

Synonyms :

Steroid 17-alpha-hydroxylase/17,20 lyase; 1.14.14.19 ; 17-alpha-hydroxyprogesterone aldolase; 4.1.2.30 ; CYPXVII; Cytochrome P450 17A1; Cytochrome P450-C17; Cytochrome P450c17; Steroid 17-alpha-monooxygenase; CYP17A1; CYP17, S17AH;

Protein Name :

Steroid 17-alpha-hydroxylase/17,20 lyase

Molecular Weight :

57371 MW

Protein Function :

Conversion of pregnenolone and progesterone to their 17- alpha-hydroxylated products and subsequently to dehydroepiandrosterone (DHEA) and androstenedione. Catalyzes both the 17-alpha-hydroxylation and the 17,20-lyase reaction. Involved in sexual development during fetal life and at puberty.

Subcellular Localization :

Membrane

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Background :

Cytochrome P450 17A1, also called steroid 17α-monooxygenase, is an enzyme of the hydroxylase type that in humans is encoded by the CYP17A1 gene on chromosome 10. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. It has both 17alpha-hydroxylase and 17,20-lyase activities and is a key enzyme in the steroidogenic pathway that produces progestins, mineralocorticoids, glucocorticoids, androgens, and estrogens. Mutations in this gene are associated with isolated steroid-17 alpha-hydroxylase deficiency, 17-alpha-hydroxylase/17,20-lyase deficiency, pseudohermaphroditism, and adrenal hyperplasia.

Research Category :

Cancer, Cancer Metabolism, Cardiovascular, Cytochromes, Endocrine Metabolism, Growth Factors, Growth Factors/Hormones, Hormone Biosynthesis, Lipases, Lipid And Lipoprotein Metabolism, Lipid Metabolism, Lipids / Lipoproteins, Metabolic Signaling Pathway, Metabolic Signaling Pathways, Metabolism, Metabolism Of Lipids And Lipoproteins, Mitochondrial Metabolism, Pathways And Processes, Signal Transduction