This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-GSTM1 Antibody Picoband™
catalog :
A00569-1
quantity :
100µg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunocytochemistry, flow cytometry
product information
SKU :
A00569-1
Product Name :
Anti-GSTM1 Antibody Picoband™
Size :
100µg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
Flow Cytometry, IF, ICC, WB
Application Details :
Western blot, 0.1-0.5µg/ml.
Immunocytochemistry/Immunofluorescence, 5 µg/ml.
Flow Cytometry, 1-3μg/1x10^6 cells
Description :
Boster Bio Anti-GSTM1 Antibody Picoband™ catalog # A00569-1. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
GSTM1
Uniprot ID :
P09488
Immunogen :
A synthetic peptide corresponding to a sequence of human GSTM1 (EEEKIRVDILENQTMDNHMQLGMICYNPEFEKLK).
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
glutathione S-transferase mu 1
Synonyms :
Glutathione S-transferase Mu 1; GST HB subunit 4; GST class-mu 1; GSTM1-1; GSTM1a-1a; GSTM1b-1b; GTH4; GSTM1; GST1
Protein Function :
Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Subcellular Localization :
Cytoplasm
Tissue Specificity :
Liver (at protein level).
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for ICC.
Background :
Glutathione S-transferase Mu 1 (gene name GSTM1) is a human glutathione S-transferase. Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Null mutations of this class mu gene have been linked with an increase in a number of cancers, likely due to an increased susceptibility to environmental toxins and carcinogens. Multiple protein isoforms are encoded by transcript variants of this gene.
Research Category :
Cancer, Cell Type Markers, Drug Metabolism, Metabolic Signaling Pathways, Metabolism, Pathways And Processes, Signal Transduction, Tags & Cell Markers, Tumor Associated
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments