This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Human CD5 DyLight® 550 conjugated Antibody
catalog :
A00480-Dyl550
quantity :
50 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
DyLight 550
reactivity :
human
application :
flow cytometry
product information
SKU :
A00480-Dyl550
Product Name :
Anti-Human CD5 DyLight® 550 conjugated Antibody
Size :
50 ug/vial
Clonality :
Polyclonal
Host :
Rabbit
Conjugate :
DyLight®550
Reactivity :
Human
Application(s) :
Flow Cytometry
Application Details :
Flow Cytometry, 1-3μg/1x10^6 cells
Description :
Boster Bio Anti-Human CD5 DyLight® 550 conjugated Antibody catalog # A00480-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.
Concentration :
0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
Gene Name :
CD5
Uniprot ID :
P06127
Immunogen :
A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH).
Form :
Liquid
Contents :
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.
Gene Full Name :
CD5 molecule
Synonyms :
T-cell surface glycoprotein CD5; Lymphocyte antigen T1/Leu-1; CD5; CD5; LEU1
Protein Function :
May act as a receptor in regulating T-cell proliferation.
Subcellular Localization :
Cell membrane; Single-pass type I membrane protein.
Background :
CD5 is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. In humans, the gene is located on the long arm of chromosome 11. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.
Research Category :
Adaptive Immunity, B Cells, Hematopoietic Progenitors, Immunology, Lymphoid, Stem Cells, T Cells, T Lymphocytic Lineage
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments