Anti-Human CD5 DyLight® 488 conjugated Antibody | Boster A00480-Dyl488 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Human CD5 DyLight® 488 conjugated Antibody

catalog :

A00480-Dyl488

quantity :

50 ug/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

DyLight488

reactivity :

human

application :

flow cytometry

product information

SKU :

A00480-Dyl488

Product Name :

Anti-Human CD5 DyLight® 488 conjugated Antibody

Size :

50 ug/vial

Clonality :

Polyclonal

Host :

Rabbit

Conjugate :

DyLight®488

Reactivity :

Human

Application(s) :

Flow Cytometry

Application Details :

Flow Cytometry, 1-3μg/1x10^6 cells

Description :

Boster Bio Anti-Human CD5 DyLight® 488 conjugated Antibody catalog # A00480-Dyl488. Tested in Flow Cytometry applications. This antibody reacts with Human.

Concentration :

0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.

Gene Name :

CD5

Uniprot ID :

P06127

Immunogen :

A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH).

Form :

Liquid

Contents :

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.

Gene Full Name :

CD5 molecule

Synonyms :

T-cell surface glycoprotein CD5; Lymphocyte antigen T1/Leu-1; CD5; CD5; LEU1

Protein Function :

May act as a receptor in regulating T-cell proliferation.

Subcellular Localization :

Cell membrane; Single-pass type I membrane protein.

Background :

CD5 is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. In humans, the gene is located on the long arm of chromosome 11. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Research Category :

Adaptive Immunity, B Cells, Hematopoietic Progenitors, Immunology, Lymphoid, Stem Cells, T Cells, T Lymphocytic Lineage