Anti-CD5 Antibody Picoband™ | Boster A00480-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-CD5 Antibody Picoband™

catalog :

A00480-1

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, flow cytometry

product information

SKU :

A00480-1

Product Name :

Anti-CD5 Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Flow Cytometry, WB

Application Details :

Western blot, 0.1-0.5µg/ml. Flow Cytometry, 1-3μg/1x10^6 cells

Description :

Boster Bio Anti-CD5 Antibody Picoband™ catalog # A00480-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

CD5

Uniprot ID :

P06127

Immunogen :

A synthetic peptide corresponding to a sequence of human CD5 (KKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSH).

Form :

Lyophilized

Contents :

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

CD5 molecule

Synonyms :

T-cell surface glycoprotein CD5; Lymphocyte antigen T1/Leu-1; CD5; CD5; LEU1

Protein Function :

May act as a receptor in regulating T-cell proliferation.

Subcellular Localization :

Cell membrane; Single-pass type I membrane protein.

Recommended Detection Systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

CD5 is a member of the scavenger receptor cysteine-rich (SRCR) superfamily. Members of this family are secreted or membrane-anchored proteins mainly found in cells associated with the immune system. In humans, the gene is located on the long arm of chromosome 11. This protein is a type-I transmembrane glycoprotein found on the surface of thymocytes, T lymphocytes and a subset of B lymphocytes. The encoded protein contains three SRCR domains and may act as a receptor to regulate T-cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Research Category :

Adaptive Immunity, B Cells, Hematopoietic Progenitors, Immunology, Lymphoid, Stem Cells, T Cells, T Lymphocytic Lineage