antibody

Anti-TANK Antibody Picoband™

A00445-3

100µg/vial

polyclonal

domestic rabbit

nonconjugated

human, mouse, rat

western blot, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

Anti-TANK Antibody Picoband™

100µg/vial

Polyclonal

Rabbit

Human, Mouse, Rat

Flow Cytometry, IHC-P, IHC-F, WB

Western blot, 0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml. Immunohistochemistry (Frozen Section), 0.5-1µg/ml, Human. Flow Cytometry, 1-3µg/1x10^6 cells, Human

Boster Bio Anti-TANK Antibody Picoband™ catalog # A00445-3. Tested in Flow Cytometry, IHC-P, IHC-F, WB applications. This antibody reacts with Human, Mouse, Rat.

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

TANK

Q92844

A synthetic peptide corresponding to a sequence of human TANK (MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQK).

Lyophilized

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

No cross reactivity with other proteins.

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

TRAF family member associated NFKB activator

TRAF family member-associated NF-kappa-B activator; TRAF-interacting protein; I-TRAF; TANK; ITRAF; TRAF2

Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining them in a latent state. Blocks TRAF2 binding to LMP1 and inhibits LMP1-mediated NF-kappa-B activation. Negatively regulates NF-kappaB signaling and cell survival upon DNA damage (PubMed:25861989). Plays a role as an adapter to assemble ZC3H12A, USP10 in a deubiquitination complex which plays a negative feedback response to attenuate NF-kappaB activation through the deubiquitination of IKBKG or TRAF6 in response to interleukin-1-beta (IL1B) stimulation or upon DNA damage (PubMed:25861989). Promotes UBP10-induced deubiquitination of TRAF6 in response to DNA damage (PubMed:25861989). May control negatively TRAF2-mediated NF-kappa-B activation signaled by CD40, TNFR1 and TNFR2.

Cytoplasm

Ubiquitous.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and IHC(F).

TRAF family member-associated NF-kappa-B activator is a protein that in humans is encoded by the TANKgene. It is mapped to 2q24.2. The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to TRAF1, TRAF2, or TRAF3, thereby inhibiting TRAF function by sequestering the TRAFs in a latent state in the cytoplasm. For example, the protein encoded by this gene can block TRAF2 binding to LMP1, the Epstein-Barr virus transforming protein, and inhibit LMP1-mediated NF-kappa-B activation. Three alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Growth Factors/Hormones, Immunology, Innate Immunity, Nfkb Pathway, Nuclear Signaling, Signal Transduction, Signaling Pathway, Tlr Signaling