Anti-Leptin Receptor/LEPR Antibody Picoband™ | Boster A00350 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Leptin Receptor/LEPR Antibody Picoband™

catalog :

A00350

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

immunohistochemistry

product information

SKU :

A00350

Product Name :

Anti-Leptin Receptor/LEPR Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

ELISA, IHC

Application Details :

Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Mouse, Rat, Human, By Heat. ELISA, 0.1-0.5µg/ml, Human.

Application Notes :

Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Leptin Receptor/LEPR Antibody Picoband™ catalog # A00350. Tested in ELISA, IHC applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

LEPR

Uniprot ID :

P48357

Immunogen :

different from the related mouse sequence by nine amino acids, and from the related rat sequence by eig
KKYYIHDHFIPIEKYQFSLYPIFMEGVGKPKIINSFTQD
DIEKHQSD),
A synthetic peptide corresponding to a sequence at the C-terminus of human Leptin Receptor (793-839aa

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Leptin receptor

Synonyms :

Leptin receptor; LEP-R; HuB219; OB receptor; OB-R; CD295; LEPR; DB, OBR;

Protein Name :

Leptin receptor

Molecular Weight :

132494 MW

Protein Function :

Receptor for obesity factor (leptin). On ligand binding, mediates signaling through JAK2/STAT3. Involved in the regulation of fat metabolism and, in a hematopoietic pathway, required for normal lymphopoiesis. May play a role in reproduction. Can also mediate the ERK/FOS signaling pathway (By similarity).

Subcellular Localization :

Cell membrane; Single-pass type I membrane protein.

Tissue Specificity :

Isoform A is expressed in fetal liver and in hematopoietic tissues and choroid plexus. In adults highest expression in heart, liver, small intestine, prostate and ovary. Low level in lung and kidney. Isoform B is highly expressed in hypothalamus.

Recommended Detection Systems :

Boster recommends HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Background :

Leptin receptor, also known as LEP-R or OB-R is a protein that in humans is encoded by the LEPR gene. The protein encoded by this gene belongs to the gp130 family of cytokine receptors that are known to stimulate gene transcription via activation of cytosolic STAT proteins. This protein is a receptor for leptin (an adipocyte-specific hormone that regulates body weight), and is involved in the regulation of fat metabolism, as well as in a novel hematopoietic pathway that is required for normal lymphopoiesis. Mutations in this gene have been associated with obesity and pituitary dysfunction. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Research Category :

Collagen, Cytoskeleton / Ecm, Ecm Proteins, Extracellular Matrix, Signal Transduction, Structures