Anti-JAK1 Antibody Picoband™ | Boster A00330 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-JAK1 Antibody Picoband™

catalog :

A00330

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

SKU :

A00330

Product Name :

Anti-JAK1 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-JAK1 Antibody Picoband™ catalog # A00330. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

JAK1

Uniprot ID :

P23458

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human JAK1 (78-115aa FALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTN), different from the related mouse sequence by three amino acids.

Form :

Lyophilized

Contents :

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Tyrosine-protein kinase JAK1

Synonyms :

Tyrosine-protein kinase JAK1; 2.7.10.2; Janus kinase 1; JAK-1; JAK1; JAK1A, JAK1B;

Protein Name :

Tyrosine-protein kinase JAK1

Molecular Weight :

133277 MW

Protein Function :

Tyrosine kinase of the non-receptor type, involved in the IFN-alpha/beta/gamma signal pathway. Kinase partner for the interleukin (IL)-2 receptor.

Subcellular Localization :

Endomembrane system; Peripheral membrane protein. Wholly intracellular, possibly membrane associated.

Tissue Specificity :

Expressed at higher levels in primary colon tumors than in normal colon tissue. The expression level in metastatic colon tumors is comparable to the expression level in normal colon tissue.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

JAK1 (JANUS KINASE 1) is a human tyrosine kinase protein essential for signaling for certain type I and type II cytokines. It is a member of a new class of PTKs that are a large family of proteins characterized by the presence of a second phosphotransferase-related domain immediately N-terminal to the PTK domain--hence the name Janus. The JAK1 gene is mapped to 1p31.3. JAK1 is also important for transducing a signal by type I (IFN-α/β) and type II (IFN-γ) interferons, and members of the IL-10 family via type II cytokine receptors. Additionally, Jak1 plays a critical role in initiating responses to multiple major cytokine receptor families. Loss of Jak1 is lethal in neonatal mice, possibly due to difficulties suckling. Expression of JAK1 in cancer cells enables individual cells to contract, potentially allowing them to escape their tumor and metastasize to other parts of the body.

Research Category :

Apoptosis, Cancer, Cell Biology, Epigenetics and Nuclear Signaling, Intracellular, Kinases, Nuclear Signaling Pathways, Oncoproteins, Oncoproteins/Suppressors, Protein Phosphorylation, Signal Transduction, Tyrosine Kinases