This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-IFNAR1 Antibody Picoband™
catalog :
A00306-2
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot
product information
SKU :
A00306-2
Product Name :
Anti-IFNAR1 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse
Application(s) :
WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human, Mouse.
Application Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-IFNAR1 Antibody Picoband™ catalog # A00306-2. Tested in WB applications. This antibody reacts with Human, Mouse.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
IFNAR1
Uniprot ID :
P17181
Immunogen :
HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKG
IYLLR).
A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1 (263-306aa
IYLLR).
A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1 (263-306aa
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Interferon alpha/beta receptor 1
Synonyms :
Interferon alpha/beta receptor 1; IFN-R-1; IFN-alpha/beta receptor 1; Cytokine receptor class-II member 1; Cytokine receptor family 2 member 1; CRF2-1; Type I interferon receptor 1; IFNAR1; IFNAR;
Protein Name :
Interferon alpha/beta receptor 1
Molecular Weight :
63525 MW
Protein Function :
Component of the receptor for type I interferons, including interferons alpha, IFNB1 and IFNW1 (PubMed:2153461, PubMed:7665574, PubMed:10049744, PubMed:14532120, PubMed:15337770, PubMed:21854986). Functions in general as heterodimer with IFNAR2 (PubMed:7665574, PubMed:10049744, PubMed:21854986). Type I interferon binding activates the JAK-STAT signaling cascade, and triggers tyrosine phosphorylation of a number of proteins including JAKs, TYK2, STAT proteins and the IFNR alpha- and beta- subunits themselves (PubMed:7665574, PubMed:21854986). Can form an active IFNB1 receptor by itself and activate a signaling cascade that does not involve activation of the JAK-STAT pathway (By similarity).
Subcellular Localization :
Isoform 1: Cell membrane ; Single- pass type I membrane protein. Late endosome. Lysosome. Interferon binding triggers internalization of the receptor from the cell membrane into endosomes and then into lysosomes.
Tissue Specificity :
IFN receptors are present in all tissues and even on the surface of most IFN-resistant cells. Isoform 1, isoform 2 and isoform 3 are expressed in the IFN-alpha sensitive myeloma cell line U266B1. Isoform 2 and isoform 3 are expressed in the IFN-alpha resistant myeloma cell line U266R. Isoform 1 is not expressed in IFN-alpha resistant myeloma cell line U266R.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
Interferon-alpha/beta receptor alpha chain is a protein that in humans is encoded by the IFNAR1 gene. The protein encoded by this gene is a type I membrane protein that forms one of the two chains of a receptor for interferons alpha and beta. Binding and activation of the receptor stimulates Janus protein kinases, which in turn phosphorylate several proteins, including STAT1 and STAT2. The encoded protein also functions as an antiviral factor.
Research Category :
Cancer, Cytokines, Epigenetics and Nuclear Signaling, Immunology, Innate Immunity, Interferons, Nuclear Signaling, Nuclear Signaling Pathways, Signal Transduction, Signaling Pathway, Tumor Immunology
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments