This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-C Reactive Protein/CRP Antibody Picoband™
catalog :
A00249-4
quantity :
100µg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse
application :
western blot, immunohistochemistry
product information
SKU :
A00249-4
Product Name :
Anti-C Reactive Protein/CRP Antibody Picoband™
Size :
100µg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse
Application(s) :
IHC, WB
Application Details :
Western blot, 0.1-0.5µg/ml.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml.
Description :
Boster Bio Anti-C Reactive Protein/CRP Antibody Picoband™ catalog # A00249-4. Tested in IHC, WB applications. This antibody reacts with Human, Mouse.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
CRP
Uniprot ID :
P02741
Immunogen :
A synthetic peptide corresponding to a sequence of human C Reactive Protein (QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA).
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
C-reactive protein
Synonyms :
C-reactive protein; C-reactive protein (1-205); CRP; PTX1
Protein Function :
Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells.
Subcellular Localization :
Secreted.
Tissue Specificity :
Found in plasma.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Background :
C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities associated with preimmune nonspecific host resistance. CRP shows the strongest association with cardiovascular events. It is detectable on the surface of about 4% of normal peripheral blood lymphocytes. Acute phase reactant CRP is produced in the liver.
Research Category :
Apoptosis, Atherosclerosis, Cardiovascular, Chromatin Binding Proteins, Complement, DNA / RNA Binding, Epigenetics and Nuclear Signaling, Immunology, Innate Immunity, Macrophage / Inflamm., Metabolism, Vascular Inflammation
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments