Anti-C Reactive Protein/CRP Antibody Picoband™ | Boster A00249-4 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-C Reactive Protein/CRP Antibody Picoband™

catalog :

A00249-4

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry

product information

SKU :

A00249-4

Product Name :

Anti-C Reactive Protein/CRP Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse

Application(s) :

IHC, WB

Application Details :

Western blot, 0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml.

Description :

Boster Bio Anti-C Reactive Protein/CRP Antibody Picoband™ catalog # A00249-4. Tested in IHC, WB applications. This antibody reacts with Human, Mouse.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

CRP

Uniprot ID :

P02741

Immunogen :

A synthetic peptide corresponding to a sequence of human C Reactive Protein (QTDMSRKAFVFPKESDTSYVSLKAPLTKPLKA).

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

C-reactive protein

Synonyms :

C-reactive protein; C-reactive protein (1-205); CRP; PTX1

Protein Function :

Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells.

Subcellular Localization :

Secreted.

Tissue Specificity :

Found in plasma.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Background :

C Reactive Protein (CRP) is a major acute phase reactant synthesized primarily in the liver hepatocytes. It is composed of 5 identical, 21,500-molecular weight subunits. CRP mediates activities associated with preimmune nonspecific host resistance. CRP shows the strongest association with cardiovascular events. It is detectable on the surface of about 4% of normal peripheral blood lymphocytes. Acute phase reactant CRP is produced in the liver.

Research Category :

Apoptosis, Atherosclerosis, Cardiovascular, Chromatin Binding Proteins, Complement, DNA / RNA Binding, Epigenetics and Nuclear Signaling, Immunology, Innate Immunity, Macrophage / Inflamm., Metabolism, Vascular Inflammation