Anti-GAPDH Antibody Picoband™ | Boster A00227 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-GAPDH Antibody Picoband™

catalog :

A00227

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot

product information

SKU :

A00227

Product Name :

Anti-GAPDH Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml, Human.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-GAPDH Antibody Picoband™ catalog # A00227. Tested in WB applications. This antibody reacts with Human.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

GAPDH

Uniprot ID :

P04406

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human GAPDH (302-335aa ALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE), different from the related mouse and rat sequences by three amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Glyceraldehyde-3-phosphate dehydrogenase

Synonyms :

Glyceraldehyde-3-phosphate dehydrogenase; GAPDH; 1.2.1.12; Peptidyl-cysteine S-nitrosylase GAPDH; 2.6.99.-; GAPDH; GAPD; CDABP0047, OK/SW-cl.12;

Protein Name :

Glyceraldehyde-3-phosphate dehydrogenase

Molecular Weight :

36053 MW

Protein Function :

Has both glyceraldehyde-3-phosphate dehydrogenase and nitrosylase activities, thereby playing a role in glycolysis and nuclear functions, respectively. Participates in nuclear events including transcription, RNA transport, DNA replication and apoptosis. Nuclear functions are probably due to the nitrosylase activity that mediates cysteine S-nitrosylation of nuclear target proteins such as SIRT1, HDAC2 and PRKDC. Modulates the organization and assembly of the cytoskeleton. Facilitates the CHP1-dependent microtubule and membrane associations through its ability to stimulate the binding of CHP1 to microtubules (By similarity). Glyceraldehyde-3-phosphate dehydrogenase is a key enzyme in glycolysis that catalyzes the first step of the pathway by converting D-glyceraldehyde 3-phosphate (G3P) into 3-phospho-D- glyceroyl phosphate. Component of the GAIT (gamma interferon- activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes. Upon interferon-gamma treatment assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation.

Subcellular Localization :

Cytoplasm, cytosol. Nucleus. Cytoplasm, perinuclear region. Membrane. Cytoplasm, cytoskeleton. Translocates to the nucleus following S- nitrosylation and interaction with SIAH1, which contains a nuclear localization signal (By similarity). Postnuclear and Perinuclear regions.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

Glyceraldehyde 3-phosphate dehydrogenase (abbreviated as GAPDH or less commonly as G3PDH) is an enzyme of ~37kDa that catalyzes the sixth step of glycolysis and thus serves to break down glucose for energy and carbon molecules. This gene encodes a member of the glyceraldehyde-3-phosphate dehydrogenase protein family. GAPDH is mapped to 12p13.31. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The product of this gene catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The encoded protein has additionally been identified to have uracil DNA glycosylase activity in the nucleus.

Research Category :

Alzheimer'S Disease, Cancer, Cancer Metabolism, Carbohydrate Metabolism, Energy Metabolism, Energy Transfer Pathways, Metabolic Signaling Pathway, Metabolic Signaling Pathways, Metabolism, Metabolism Of Carbohydrates, Neurodegenerative Disease, Neurology Process, Neuroscience, Pathways And Processes, Signal Transduction