antibody

Anti-AHR Antibody Picoband™

A00225-2

100µg/vial

polyclonal

domestic rabbit

nonconjugated

human, mouse, rat

western blot, immunohistochemistry, immunocytochemistry, flow cytometry

Anti-AHR Antibody Picoband™

100µg/vial

Polyclonal

Rabbit

Human, Mouse, Rat

Flow Cytometry, IHC, ICC, WB

Western blot, 0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml. Immunohistochemistry (Frozen Section), 0.5-1µg/ml. Immunocytochemistry, 0.5-1µg/ml. Flow Cytometry, 1-3μg/1x10^6 cells.

Boster Bio Anti-AHR Antibody Picoband™ catalog # A00225-2. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

AHR

P35869

A synthetic peptide corresponding to a sequence of human AHR (AFLNKFQNGVLNETYPAELNNINNTQTTTHLQPLHH).

Lyophilized

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

No cross reactivity with other proteins.

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

aryl hydrocarbon receptor

Aryl hydrocarbon receptor; Ah receptor; AhR; Class E basic helix-loop-helix protein 76; bHLHe76; AHR; BHLHE76

Ligand-activated transcriptional activator. Binds to the XRE promoter region of genes it activates. Activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Involved in cell-cycle regulation. Likely to play an important role in the development and maturation of many tissues. Regulates the circadian clock by inhibiting the basal and circadian expression of the core circadian component PER1. Inhibits PER1 by repressing the CLOCK-ARNTL/BMAL1 heterodimer mediated transcriptional activation of PER1.

Cytoplasm. Nucleus. Initially cytoplasmic; upon binding with ligand and interaction with a HSP90, it translocates to the nucleus.

Expressed in all tissues tested including blood, brain, heart, kidney, liver, lung, pancreas and skeletal muscle.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

AHR (aryl hydrocarbon receptor), also called bHLHe76, is a member of the family of basic helix-loop-helix transcription factors. AhR is a cytosolic transcription factor that is normally inactive, bound to several co-chaperones. The AHR gene is mapped on 7p21.1. Estrogenic actions of AHR agonists were detected in wildtype ovariectomized mouse uteri, but were absent in Ahr -/- or Er-alpha -/- ovariectomized mice. Complex assembly and ubiquitin ligase activity of CUL4B (AHR) in vitro and in vivo are dependent on the AHR ligand. In the CUL4B (AHR) complex, ligand-activated AHR acts as a substrate-specific adaptor component that targets sex steroid receptors for degradation. Cd4-positive cells from mice lacking Ahr developed Th17 responses but failed to produce Il22 and did not show enhanced Th17 development. Activation of Ahr during induction of EAE accelerated disease onset and increased pathology in wildtype mice, but not in Ahr -/- mice. The TDO-AHR pathway is active in human brain tumors and is associated with malignant progression and poor survival. Ahr activity within ROR-gamma-t-positive ILC could be induced by dietary ligands such as those contained in vegetables of the family Brassicaceae.

Epigenetics and Nuclear Signaling, Nfkb Pathway, Nuclear Signaling Pathways