Anti-HLA-B Picoband Antibody | Boster A00186-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-HLA-B Picoband Antibody

catalog :

A00186-1

quantity :

100 ug/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot

product information

sku :

A00186-1

status :

Enabled

name :

Anti-HLA-B Picoband Antibody

category name :

Primary Antibodies, Polyclonal Antibodies

gene name :

HLA-B

price various sizes :

30ug sample size / $99 100ug / $240 100ug+Free HRP Secondary BA1054 / $240 100ug+Free Biotin Secondary BA1003 / $240

clonality :

Polyclonal

concentration :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

conjugate :

contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

description :

Polyclonal antibody for HLA-B detection. Host: Rabbit.Size: 100ug/vial. Tested applications: WB. Reactive species: Human. HLA-B information: Molecular Weight: 10606 MW; .

short description :

Rabbit IgG polyclonal antibody for MHC class I antigen(HLA-B) detection. Tested with WB in Human.

size :

100 ug/vial

sample size available :

30ug for $99, contact us for details

uniprot id :

O19569

host :

Rabbit

immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human HLA-B (52-89aa EQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEA).

form :

Lyophilized

purification :

Immunogen affinity purified.

storage :

At -20 C for one year. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for a longer time.Avoid repeated freezing and thawing.

cross reactivity :

No cross reactivity with other proteins.

reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

application details :

Western blot, 0.1-0.5ug/ml, Human.

applications :

reactivity :

Human

image labels :

Figure 1. Western blot analysis of HLA-B using anti- HLA-B antibody (A00186-1). . Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: HELA whole Cell lysates, . Lane 2: HEPG2 whole Cell lysates, . Lane 3: SGC7901 whole Cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- HLA-B antigen affinity purified polyclonal antibody (Catalog # A00186-1) at 0.5 ug/mL overnight at 4Â°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for HLA-B at approximately 45KD. The expected band size for HLA-B is at 45KD.

background :

HLA-B (major histocompatibility complex, class I, B) is a human gene that provides instructions for making a protein that plays a critical role in the immune system. HLA-B is part of a family of genes called the human leukocyte antigen (HLA) complex. The HLA complex helps the immune system distinguish the body's own proteins from proteins made by foreign invaders such as viruses and bacteria. The HLA-B gene is located on the short (p) arm of chromosome 6.

competitor equivalent skus :

sc 59233 sc 8606 sc 377101 sc 8607

synonyms :

MHC class I antigen ;HLA-B ;

gene full name :

major histocompatibility complex, class I, B

molecular weight :

10606 MW

protein name :

MHC class I antigen

recommended detection systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

last modified :

3/14/19 9:21