This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-HLA-B Picoband Antibody
catalog :
A00186-1
quantity :
100 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
sku :
A00186-1
status :
Enabled
name :
Anti-HLA-B Picoband Antibody
category name :
Primary Antibodies, Polyclonal Antibodies
gene name :
HLA-B
price various sizes :
30ug sample size / $99 100ug / $240 100ug+Free HRP Secondary BA1054 / $240 100ug+Free Biotin Secondary BA1003 / $240
clonality :
Polyclonal
concentration :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
conjugate :
No
contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
description :
Polyclonal antibody for HLA-B detection. Host: Rabbit.Size: 100ug/vial. Tested applications: WB. Reactive species: Human. HLA-B information: Molecular Weight: 10606 MW; .
short description :
Rabbit IgG polyclonal antibody for MHC class I antigen(HLA-B) detection. Tested with WB in Human.
size :
100 ug/vial
sample size available :
30ug for $99, contact us for details
uniprot id :
O19569
host :
Rabbit
immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human HLA-B (52-89aa EQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEA).
form :
Lyophilized
purification :
Immunogen affinity purified.
storage :
At -20 C for one year. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for a longer time.Avoid repeated freezing and thawing.
cross reactivity :
No cross reactivity with other proteins.
reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
application details :
Western blot, 0.1-0.5ug/ml, Human.
applications :
WB
reactivity :
Human
image labels :
Figure 1. Western blot analysis of HLA-B using anti- HLA-B antibody (A00186-1). . Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: HELA whole Cell lysates, . Lane 2: HEPG2 whole Cell lysates, . Lane 3: SGC7901 whole Cell lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- HLA-B antigen affinity purified polyclonal antibody (Catalog # A00186-1) at 0.5 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for HLA-B at approximately 45KD. The expected band size for HLA-B is at 45KD.
background :
HLA-B (major histocompatibility complex, class I, B) is a human gene that provides instructions for making a protein that plays a critical role in the immune system. HLA-B is part of a family of genes called the human leukocyte antigen (HLA) complex. The HLA complex helps the immune system distinguish the body's own proteins from proteins made by foreign invaders such as viruses and bacteria. The HLA-B gene is located on the short (p) arm of chromosome 6.
competitor equivalent skus :
sc 59233 sc 8606 sc 377101 sc 8607
synonyms :
MHC class I antigen ;HLA-B ;
gene full name :
major histocompatibility complex, class I, B
molecular weight :
10606 MW
protein name :
MHC class I antigen
recommended detection systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
last modified :
3/14/19 9:21
company information

Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments