This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Human Bax DyLight® 488 conjugated Antibody
catalog :
A00183-Dyl488
quantity :
50 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
DyLight488
reactivity :
human
application :
flow cytometry
product information
SKU :
A00183-Dyl488
Product Name :
Anti-Human Bax DyLight® 488 conjugated Antibody
Size :
50 ug/vial
Clonality :
Polyclonal
Host :
Rabbit
Conjugate :
DyLight®488
Reactivity :
Human
Application(s) :
Flow Cytometry
Application Details :
Flow Cytometry, 1-3μg/1x10^6 cells
Description :
Boster Bio Anti-Human Bax DyLight® 488 conjugated Antibody catalog # A00183-Dyl488. Tested in Flow Cytometry applications. This antibody reacts with Human.
Concentration :
0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
Gene Name :
BAX
Uniprot ID :
Q07812
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids.
Form :
Liquid
Contents :
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.
Gene Full Name :
BCL2-associated X protein
Synonyms :
Apoptosis regulator BAX; Bcl-2-like protein 4; Bcl2-L-4; BAX; BCL2L4
Protein Function :
Accelerates programmed cell death by binding to, and antagonizing the apoptosis repressor BCL2 or its adenovirus homolog E1B 19k protein. Under stress conditions, undergoes a conformation change that causes translocation to the mitochondrion membrane, leading to the release of cytochrome c that then triggers apoptosis. Promotes activation of CASP3, and thereby apoptosis.
Subcellular Localization :
Isoform Alpha: Mitochondrion membrane; Colocalizes with 14- 3-3 proteins in the cytoplasm. Under stress conditions, undergoes a conformation change that causes release from JNK-phosphorylated 14-3-3 proteins and translocation to the mitochondrion membrane.
Tissue Specificity :
Expressed in a wide variety of tissues. Isoform Psi is found in glial tumors. Isoform Alpha is expressed in spleen, breast, ovary, testis, colon and brain, and at low levels in skin and lung. Isoform Sigma is expressed in spleen, breast, ovary, testis, lung, colon, brain and at low levels in skin. Isoform Alpha and isoform Sigma are expressed in pro- myelocytic leukemia, histiocytic lymphoma, Burkitt's lymphoma, T- cell lymphoma, lymphoblastic leukemia, breast adenocarcinoma, ovary adenocarcinoma, prostate carcinoma, prostate adenocarcinoma, lung carcinoma, epidermoid carcinoma, small cell lung carcinoma and colon adenocarcinoma cell lines.
Background :
Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
Research Category :
Apoptosis, Apoptotic Markers, Associated Proteins, Cancer, Cell Biology, Cell Death, Intracellular, Invasion/Microenvironment, Metabolism, Metabolism Processes, Pathways And Processes
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits