Anti-PD-1/PDCD1 Antibody Picoband™ | Boster A00178 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-PD-1/PDCD1 Antibody Picoband™

catalog :

A00178

quantity :

100 μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

polyclonal

reactivity :

mouse

application :

western blot, flow cytometry, immunohistochemistry - paraffin section

product information

SKU :

A00178

Product Name :

Anti-PD-1/PDCD1 Antibody Picoband™

Size :

100 μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Mouse, Rat

Application(s) :

Flow Cytometry, IHC-P, WB

Application Details :

Western blot, 0.1-0.5 μg/ml, Mouse, Rat. Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Mouse, Rat, By Heat. Flow Cytometry, 1-3 μg/1x10^6 cells, Mouse.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-PD-1 PDCD1 Antibody catalog # A00178. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Mouse, Rat.

Gene Name :

Pdcd1

Uniprot ID :

Q02242

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of mouse PD1 (84-117aa NGLSQPVQDARFQIIQLPNRHDFHMNILDTRRND), different from the related human sequence by fifteen amino acids.

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Storage :

At -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freezing and thawing.

Reconstitution :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Full Name :

bromodomain containing 2

Synonyms :

Bromodomain-containing protein 2; O27.1.1; Really interesting new gene 3 protein; BRD2; KIAA9001; RING3

Protein Function :

May play a role in spermatogenesis or folliculogenesis (By similarity). Binds hyperacetylated chromatin and plays a role in the regulation of transcription, probably by chromatin remodeling. Regulates transcription of the CCND1 gene. Plays a role in nucleosome assembly.

Subcellular Localization :

Nucleus.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for ICC.

Background :

Bromodomain-containing protein 2 is a protein that in humans is encoded by the BRD2 gene. It is mapped to 6p21.32. This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene.