This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-PD-1/PDCD1 Antibody Picoband™
catalog :
A00178
quantity :
100 μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
clone name :
polyclonal
reactivity :
mouse
application :
western blot, flow cytometry, immunohistochemistry - paraffin section
product information
SKU :
A00178
Product Name :
Anti-PD-1/PDCD1 Antibody Picoband™
Size :
100 μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Mouse, Rat
Application(s) :
Flow Cytometry, IHC-P, WB
Application Details :
Western blot, 0.1-0.5 μg/ml, Mouse, Rat.
Immunohistochemistry(Paraffin-embedded Section), 2-5 μg/ml, Mouse, Rat, By Heat.
Flow Cytometry, 1-3 μg/1x10^6 cells, Mouse.
Application Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-PD-1 PDCD1 Antibody catalog # A00178. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Mouse, Rat.
Gene Name :
Pdcd1
Uniprot ID :
Q02242
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of mouse PD1 (84-117aa NGLSQPVQDARFQIIQLPNRHDFHMNILDTRRND), different from the related human sequence by fifteen amino acids.
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Storage :
At -20˚C for one year from date of receipt.
After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months.
Avoid repeated freezing and thawing.
Reconstitution :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Full Name :
bromodomain containing 2
Synonyms :
Bromodomain-containing protein 2; O27.1.1; Really interesting new gene 3 protein; BRD2; KIAA9001; RING3
Protein Function :
May play a role in spermatogenesis or folliculogenesis (By similarity). Binds hyperacetylated chromatin and plays a role in the regulation of transcription, probably by chromatin remodeling. Regulates transcription of the CCND1 gene. Plays a role in nucleosome assembly.
Subcellular Localization :
Nucleus.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for ICC.
Background :
Bromodomain-containing protein 2 is a protein that in humans is encoded by the BRD2 gene. It is mapped to 6p21.32. This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene.
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments