Anti-IL1 beta/Il1b Antibody Picoband™ | Boster A00101-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-IL1 beta/Il1b Antibody Picoband™

catalog :

A00101-1

quantity :

100 ug/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

mouse, rat

application :

western blot

product information

SKU :

A00101-1

Product Name :

Anti-IL1 beta/Il1b Antibody Picoband™

Size :

100 ug/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Mouse, Rat

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-IL1 beta/Il1b Antibody Picoband™ catalog # A00101-1. Tested in WB applications. This antibody reacts with Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

Il1b

Uniprot ID :

Il1b: P10749

Immunogen :

A synthetic peptide corresponding to a sequence of mouse IL1 beta (DPKQYPKKKMEKRFVFNKIEVKSKVEFESAE).

Form :

Lyophilized

Contents :

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

interleukin 1 beta

Synonyms :

Interleukin-1 beta; IL-1 beta; Il1b;

Protein Function :

Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B-cell activation and antibody production, and fibroblast proliferation and collagen production.

Subcellular Localization :

Cytoplasm, cytosol

Tissue Specificity :

Expressed in activated macrophages (at protein level).

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Research Category :

Interleukins, Metabolism, Obesity, Vascular Inflammation