This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-COX2/Cyclooxygenase 2/PTGS2 Antibody Picoband™
catalog :
A00084
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
SKU :
A00084
Product Name :
Anti-COX2/Cyclooxygenase 2/PTGS2 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.
Application Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-COX2/Cyclooxygenase 2/PTGS2 Antibody Picoband™ catalog # A00084. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
PTGS2
Uniprot ID :
P35354
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human PTGS2 (365-397aa AEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNN), different from the related mouse and rat sequences by eight amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Prostaglandin G/H synthase 2
Synonyms :
Prostaglandin G/H synthase 2; 1.14.99.1; Cyclooxygenase-2; COX-2; PHS II; Prostaglandin H2 synthase 2; PGH synthase 2; PGHS-2; Prostaglandin-endoperoxide synthase 2; PTGS2; COX2;
Protein Name :
Prostaglandin G/H synthase 2
Molecular Weight :
68996 MW
Protein Function :
Converts arachidonate to prostaglandin H2 (PGH2), a committed step in prostanoid synthesis. Constitutively expressed in some tissues in physiological conditions, such as the endothelium, kidney and brain, and in pathological conditions, such as in cancer. PTGS2 is responsible for production of inflammatory prostaglandins. Up-regulation of PTGS2 is also associated with increased cell adhesion, phenotypic changes, resistance to apoptosis and tumor angiogenesis. In cancer cells, PTGS2 is a key step in the production of prostaglandin E2 (PGE2), which plays important roles in modulating motility, proliferation and resistance to apoptosis.
Subcellular Localization :
Microsome membrane; Peripheral membrane protein. Endoplasmic reticulum membrane; Peripheral membrane protein.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
Cyclooxygenase (Cox) is the key enzyme in conversion of arachidonic acid to PGs, and two isoforms, Cox-1 and Cox-2, have been identified. Cox-2 gene encodes an inducible prostaglandin synthase enzyme that is overexpressed in adenocarcinomas and other tumors. Deletion of the murine Cox-2 gene in Min mice reduced the incidence of intestinal tumors, suggesting that it is required for tumorigenesis. This gene is localized to sites associated with retinal blood vessels, and plays an important role in blood vessel formation in the retina. And the glucocorticoid receptor suppression of COX-2 is also crucial for curtailing lethal immune activation, and suggests new therapeutic approaches for regulation of T-cell-mediated inflammatory diseases.
Research Category :
Atherosclerosis, Cancer, Cancer Metabolism, Cardiovascular, Cholesterol Metabolism, Endocrine Metabolism, Heart Disease, Hormone Biosynthesis, Lipid And Lipoprotein Metabolism, Lipid Metabolism, Lipid Signaling, Lipids / Lipoproteins, Metabolic Signaling Pathway, Metabolic Signaling Pathways, Metabolism, Pathways And Processes, Platelets, Signal Transduction, Signaling Pathway, Tumor Biomarkers
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments