Anti-P Glycoprotein/ABCB1 Antibody Picoband™ | Boster A00049-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-P Glycoprotein/ABCB1 Antibody Picoband™

catalog :

A00049-1

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry, flow cytometry

product information

SKU :

A00049-1

Product Name :

Anti-P Glycoprotein/ABCB1 Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Flow Cytometry, IF, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml. Immunocytochemistry/Immunofluorescence, 2µg/ml. Flow Cytometry, 1-3μg/1x10^6 cells

Description :

Boster Bio Anti-P Glycoprotein/ABCB1 Antibody Picoband™ catalog # A00049-1. Tested in Flow Cytometry, IF, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

ABCB1

Uniprot ID :

P08183

Immunogen :

A synthetic peptide corresponding to a sequence of human P Glycoprotein (QAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPY).

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

ATP-binding cassette, sub-family B (MDR/TAP), member 1

Synonyms :

Multidrug resistance protein 1; ATP-binding cassette sub-family B member 1; P-glycoprotein 1; CD243; ABCB1; MDR1; PGY1

Protein Function :

Energy-dependent efflux pump responsible for decreased drug accumulation in multidrug-resistant cells.

Subcellular Localization :

Cell membrane; Multi-pass membrane protein.

Tissue Specificity :

Expressed in liver, kidney, small intestine and brain.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for ICC.

Background :

P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood–brain barrier.

Research Category :

Metabolism, Mitochondrial, Mitochondrial Markers, Mitochondrial Metabolism, Pathways And Processes, Signal Transduction