Anti-Human Bcl-2 DyLight® 550 conjugated Antibody | Boster A00040-Dyl550 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Human Bcl-2 DyLight® 550 conjugated Antibody

catalog :

A00040-Dyl550

quantity :

50 ug/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

DyLight 550

reactivity :

human

application :

flow cytometry

product information

SKU :

A00040-Dyl550

Product Name :

Anti-Human Bcl-2 DyLight® 550 conjugated Antibody

Size :

50 ug/vial

Clonality :

Polyclonal

Host :

Rabbit

Conjugate :

DyLight®550

Reactivity :

Human

Application(s) :

Flow Cytometry

Application Details :

Flow Cytometry, 1-3μg/1x10^6 cells

Description :

Boster Bio Anti-Human Bcl-2 DyLight® 550 conjugated Antibody catalog # A00040-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.

Concentration :

0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.

Gene Name :

BCL2

Uniprot ID :

P10415

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences.

Form :

Liquid

Contents :

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.

Gene Full Name :

BCL2, apoptosis regulator

Synonyms :

Apoptosis regulator Bcl-2; BCL2

Protein Function :

Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1). May attenuate inflammation by impairing NLRP1-inflammasome activation, hence CASP1 activation and IL1B release (PubMed:17418785).

Subcellular Localization :

Mitochondrion outer membrane

Tissue Specificity :

Expressed in a variety of tissues.

Background :

Immunoreactive BCL2 protein in the neoplastic cells of almost all follicular lymphomas whereas no BCL2 protein was detected in follicles affected by nonneoplastic processes or in normal lymphoid tissue. Every tumor with molecular-genetic evidence of t (14;18) translocation expressed detectable levels of BCL2 protein, regardless of whether the breakpoint was located in or at a distance from the BCL2 gene. Overexpression of BCL2 blocks the apoptotic death of a pro-B-lymphocyte cell line.

Research Category :

Apoptosis, Apoptotic Markers, Cancer, Cancer Metabolism, Cell Biology, Cell Death, Hypoxia, Intracellular, Invasion/Microenvironment, Metabolism, Metabolism Processes, Mitochondrial, Mitochondrial Markers, Mitochondrial Metabolism, Oncoproteins, Oncoproteins/Suppressors, Pathways And Processes, Response To Hypoxia, Signal Transduction, Tumor Biomarkers