This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Bcl-2/BCL2 Picoband Antibody
catalog :
A00040-1
quantity :
100 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry
citations: 1
product information
sku :
A00040-1
status :
Enabled
name :
Anti-Bcl-2/BCL2 Picoband Antibody
category name :
Primary Antibodies, Polyclonal Antibodies, IHC ICC IF Antibodies
gene name :
BCL2
price various sizes :
Unconjugated / $280 APC / $330 APC-Cy7 / $330 FITC / $330 PE / $330 PE-Cy5 / $330 PE-Cy7 / $330 30ug sample size / $99 100ug / $280 100ug+Free HRP Secondary BA1054 / $280 100ug+Free Biotin Secondary BA1003 / $280
clonality :
Polyclonal
concentration :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
conjugate :
No
contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
description :
Polyclonal antibody for Bcl-2/BCL2 detection. Host: Rabbit.Size: 100ug/vial. Tested applications: WB. Reactive species: Human. Bcl-2/BCL2 information: Molecular Weight: 26266 MW; Subcellular Localization: Mitochondrion outer membrane ; Single-pass membrane protein . Nucleus membrane ; Single-pass membrane protein . Endoplasmic reticulum membrane ; Single-pass membrane protein ; Tissue Specificity: Expressed in a variety of tissues.
short description :
Rabbit IgG polyclonal antibody for Apoptosis regulator Bcl-2(BCL2) detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human;Mouse;Rat.
size :
100 ug/vial
sample size available :
30ug for $99, contact us for details
uniprot id :
P10415
host :
Rabbit
immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human Bcl-2 (102-140aa DDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRD), identical to the related mouse and rat sequences.
form :
Lyophilized
purification :
Immunogen affinity purified.
storage :
At -20?C for one year. After reconstitution, at 4?C for one month. It can also be aliquotted and stored frozen at -20?C for a longer time. Avoid repeated freezing and thawing.
cross reactivity :
No cross reactivity with other proteins.
reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
application details :
Western blot, 0.1-0.5ug/ml, Human, Mouse, Rat. Immunohistochemistry(Frozen Section), 0.5-1ug/ml, Human. Immunohistochemistry(Paraffin-embedded Section), 0.5-1ug/ml, Human, By Heat.
Immunocytochemistry, 0.5-1ug/ml, Human.
Flow Cytometry, 1-3ug/1x10 6 cells, Human
applications :
Flow Cytometry, IHC, ICC, WB
reactivity :
Human, Mouse, Rat
image labels :
Figure 1. Western blot analysis of Bcl-2 using anti-Bcl-2 antibody (A00040-1). . Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysate,. Lane 2: mouse thymus tissue lysate,. Lane 3: human MCF-7 whole Cell lysate,. Lane 4: human 22RV1 whole Cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Bcl-2 antigen affinity purified polyclonal antibody (Catalog # A00040-1) at 0.5 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Bcl-2 at approximately 29KD. The expected band size for Bcl-2 is at 26KD. Figure 2. IHC analysis of Bcl-2 using anti- Bcl-2 antibody (A00040-1). Bcl-2 was detected in paraffin-embedded section of huamn intestinal tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti- Bcl-2 Antibody (A00040-1) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 3. Flow Cytometry analysis of U937 cells using anti- Bcl-2 antibody (A00040-1). Overlay histogram showing U937 cells stained with A00040-1 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti- Bcl-2 Antibody (A00040-1,1ug/1x10 6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10ug/1x10 6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x10 6 ) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
background :
Immunoreactive BCL2 protein in the neoplastic cells of almost all follicular lymphomas whereas no BCL2 protein was detected in follicles affected by nonneoplastic processes or in normal lymphoid tissue. Every tumor with molecular-genetic evidence of t(14;18) translocation expressed detectable levels of BCL2 protein, regardless of whether the breakpoint was located in or at a distance from the BCL2 gene. Overexpression of BCL2 blocks the apoptotic death of a pro-B-lymphocyte cell line.
competitor equivalent skus :
sc 160047 sc 492 sc 7382 sc 783 sc 56018 sc 65392 sc 130308 sc 130307 sc 56015 sc 509 sc 81002 sc 70411 sc 23960 sc 492 G sc 578
research category :
Apoptosis, Apoptotic Markers, Cancer, Cancer Metabolism, Cell Biology, Cell Death, Hypoxia, Intracellular, Invasion/Microenvironment, Metabolism, Metabolism Processes, Mitochondrial, Mitochondrial Markers, Mitochondrial Metabolism, Oncoproteins, Oncoproteins/Suppressors, Pathways And Processes, Response To Hypoxia, Signal Transduction, Tumor Biomarkers
synonyms :
Apoptosis regulator Bcl-2;BCL2;
gene full name :
Apoptosis regulator Bcl-2
molecular weight :
26266 MW
protein function :
Suppresses apoptosis in a variety of cell systems including factor-dependent lymphohematopoietic and neural cells. Regulates cell death by controlling the mitochondrial membrane permeability. Appears to function in a feedback loop system with caspases. Inhibits caspase activity either by preventing the release of cytochrome c from the mitochondria and/or by binding to the apoptosis-activating factor (APAF-1).
subcellular localization :
Mitochondrion outer membrane ; Single-pass membrane protein . Nucleus membrane ; Single-pass membrane protein . Endoplasmic reticulum membrane ; Single-pass membrane protein .
tissue specificity :
Expressed in a variety of tissues.
recommended detection systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.
last modified :
4/26/19 5:52
company information

Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments
