Anti-Toll-like Receptor 4 Antibody | Boster A00017 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Toll-like Receptor 4 Antibody

catalog :

A00017

quantity :

200 ug

clonality :

polyclonal

host :

domestic goat

conjugate :

nonconjugated

reactivity :

human, mouse

application :

immunohistochemistry, immunocytochemistry

product information

sku :

A00017

status :

Enabled

name :

Anti-Toll-like Receptor 4 Antibody

category name :

Primary Antibodies, Polyclonal Antibodies, IHC ICC IF Antibodies

gene name :

TLR4

price various sizes :

200ug / $439 200ug+Free HRP Secondary BA1060 / $439 200ug+Free Biotin Secondary BA1006 / $439

clonality :

Polyclonal

concentration :

0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.

conjugate :

contents :

Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.

description :

Goat Polyclonal antibody for TLR4 detection. Tested positive for IF, IHC, WB in Human, Mouse

short description :

Goat Polyclonal antibody for TLR4 detection. Tested positive for IF, IHC, WB in Human, Mouse

size :

200 ug

uniprot id :

O00206

host :

Goat

immunogen :

Synthetic peptide corresponding to aa 161-192 (L 161 IQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC 192 ) of the N-terminal domain of human TLR4 (Toll-like receptor 4) .

form :

Liquid. In PBS containing 1mg/ml BSA and 0.1% sodium azide.

purification :

Epitope-affinity purified IgG.

storage :

-20 C

application details :

Immunocytochemistry (acetone fixed cells, >1:400) . Immunohistochemistry (paraffin sections, >1:250) . Western Blot (>1:1,000) . Suggested dilutions/conditions may not be available for all applications. Optimal conditions must be determined individually for each application.

applications :

IF, IHC

reactivity :

Human, Mouse

image labels :

Figure 2. IHC analysis of TLR4 using anti-TLR4 antibody (A00017). TLR4 was detected in paraffin-embedded section. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-TLR4 Antibody (A00017) overnight at 4 C. Biotinylated goat anti Goat IgG antibody was used as secondary antibody and incubated for 30 minutes at 37 C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1023) with DAB as the chromogen. Figure 1. IHC analysis of TLR4 using anti-TLR4 antibody (A00017). TLR4 was detected in paraffin-embedded section. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1ug/ml rabbit anti-TLR4 Antibody (A00017) overnight at 4 C. Biotinylated goat anti Goat IgG antibody was used as secondary antibody and incubated for 30 minutes at 37 C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1023) with DAB as the chromogen.

research category :

Host Virus Interaction, Immunoglobulins, Immunology, Innate Immunity, Interspecies Interaction, Macrophage / Inflamm., Microbiology, Receptors, Tlr Signaling, Vascular Inflammation

last modified :

2/6/19 22:57