Anti-Wnt7a Antibody | Boster Immunoleader RP1088 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-Wnt7a Antibody

catalog :

RP1088

quantity :

100 ug/vial

price :

200 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-Wnt7a Antibody

Catalog Number :

RP1088

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Protein Wnt-7a(WNT7A) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Price :

200 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse, rat

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human, Mouse, Rat

Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human Wnt7a (226-256aa YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK), identical to the related mouse sequence.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas – Rothschild / Schinzel phocomelia syndromes.

Reference :

1. Dang Y, Qin Y, Tang R, Mu Y, Li G, Xia M, Chen ZJ. “Variants of the WNT7A gene in Chinese patients with müllerian duct abnormalities.” Fertil Steril, 2012 Feb. 2. Kondratov AG, Kvasha SM, Stoliar LA, Romanenko AM, Zgonnyk YM, Gordiyuk VV, Kashuba EV, Rynditch AV, Zabarovsky ER, Kashuba VI. “Alterations of the WNT7A gene in clear cell renal cell carcinomas.” PLoS One, 2012.

Gene Name :

WNT7A

Protein Name :

Protein Wnt-7a

Gene Full Name :

wingless-type MMTV integration site family, member 7A

Synonyms :

Protein Wnt-7a antibody Protein Wnt-7a precursor antibody Proto oncogene Wnt7a protein antibody proto-oncogene wnt7a protein antibody wingless-type MMTV integration site family, member 7A antibody WNT7A antibody WNT7A_HUMAN antibody

Uniprot ID :

O00755

more info or order :

Boster Immunoleader product webpage