Boster Immunoleader

antibody

Anti-FABP4 Antibody

RP1085

100 ug/vial

200 USD

polyclonal

rabbit

western blot, immunohistochemistry - paraffin section

Anti-FABP4 Antibody

RP1085

Polyclonal

Rabbit IgG polyclonal antibody for Fatty acid-binding protein, adipocyte(FABP4) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

200 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: mouse, rat Predicted to work with: human

WB,IHC-P

Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Concentration: 0.5-1μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence at the N-terminus of human FABP4 (10-40aa KLVSSENFDDYMKEVGVGFATRKVAGMAKPN), identical to the related mouse and rat sequences.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Fatty acid binding proteins (FABPs) are small cytoplasmic proteins that are expressed in a highly tissue-specific manner and bind to fatty acids such as oleic and retinoic acid. Adipocyte fatty-acid-binding protein, aP2 (FABP4) is expressed in adipocytes and macrophages, and integrates inflammatory and metabolic responses. Studies in aP2-deficient mice have shown that this lipid chaperone has a significant role in several aspects of metabolic syndrome, including type 2 diabetes and atherosclerosis. It regulates allergic airway inflammation and may provide a link between fatty acid metabolism and asthma.

1. Hotamisligil, G. S.; Johnson, R. S.; Distel, R. J.; Ellis, R.; Papaioannou, V. E.; Spiegelman, B. M. : Uncoupling of obesity from insulin resistance through a targeted mutation in aP2, the adipocyte fatty acid binding protein. Science 274: 1377-1379, 1996. 2. Furuhashi, M.; Tuncman, G.; Gorgun, C. Z.; Makowski, L.; Atsumi, G.; Vaillancourt, E.; Kono, K.; Babaev, V. R.; Fazio, S.; Linton, M. F.; Sulsky, R.; Robl, J. A.; Parker, R. A.; Hotamisligil, G. S. : Treatment of diabetes and atherosclerosis by inhibiting fatty-acid-binding protein aP2. Nature 447: 959-965, 2007. 3. Shum, B. O. V.; Mackay, C. R.; Gorgun, C. Z.; Frost, M. J.; Kumar, R. K.; Hotamisligil, G. S.; Rolph, M. S. : The adipocyte fatty acid-binding protein aP2 is required in allergic airway inflammation. J. Clin. Invest. 116: 2183-2192, 2006.

FABP4

Fatty acid-binding protein, adipocyte

fatty acid binding protein 4, adipocyte

3T3-L1 lipid-binding protein antibody 422/aP2 antibody A FABP antibody A-FABP antibody adipocyte antibody Adipocyte lipid binding protein antibody Adipocyte lipid-binding protein antibody Adipocyte protein AP2 antibody Adipocyte-type fatty acid-binding protein antibody AFABP antibody ALBP antibody ALBP/Ap2 antibody aP2 antibody FABP antibody FABP4 antibody FABP4_HUMAN antibody Fatty acid binding protein 4 adipocyte antibody Fatty acid binding protein 4 antibody Fatty acid binding protein adipocyte antibody Fatty acid-binding protein 4 antibody Fatty acid-binding protein antibody Lbpl antibody Myelin P2 protein homolog antibody P15 antibody P2 adipocyte protein antibody Protein 422 antibody

P15090