Anti-KAT13D/CLOCK Antibody | Boster Immunoleader RP1082 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-KAT13D/CLOCK Antibody

catalog :

RP1082

quantity :

100 ug/vial

price :

200 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-KAT13D/CLOCK Antibody

Catalog Number :

RP1082

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Circadian locomoter output cycles protein kaput(CLOCK) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Price :

200 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse, rat

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human, Mouse, Rat

Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human KAT13D/CLOCK (75-109aa QKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEE) , different from the related mouse sequence by one amino acid, and identical to the related rat sequence.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

Clock (Circadian Locomotor Output Cycles Kaput) is also known as KAT13D. The protein encoded by this gene plays a central role in the regulation of circadian rhythms. This protein encodes a transcription factor of the basic helix-loop-helix (bHLH) family and contains DNA binding histone acetyltransferase activity. And the encoded protein forms a heterodimer with ARNTL (BMAL1) that binds E-box enhancer elements upstream of Period (PER1, PER2, PER3) and Cryptochrome (CRY1, CRY2) genes and activates transcription of these genes. PER and CRY proteins heterodimerize and repress their own transcription by interacting in a feedback loop with CLOCK/ARNTL complexes. Polymorphisms in this gene may be associated with behavioral changes in certain populations and with obesity and metabolic syndrome. Alternative splicing results in multiple transcript variants.

Reference :

1. Dunlap JC (Jan 1999). "Molecular bases for circadian clocks". Cell 96 (2): 271–90. 2. King DP, Zhao Y, Sangoram AM, Wilsbacher LD, Tanaka M, Antoch MP, Steeves TD, Vitaterna MH, Kornhauser JM, Lowrey PL, Turek FW, Takahashi JS (May 1997). "Positional cloning of the mouse circadian clock gene". Cell 89 (4): 641–653. 3. Vitaterna MH, King DP, Chang AM, Kornhauser JM, Lowrey PL, McDonald JD, Dove WF, Pinto LH, Turek FW, Takahashi JS (Apr 1994). "Mutagenesis and mapping of a mouse gene, Clock, essential for circadian behavior". Science 264 (5159): 719–25.

Gene Name :

CLOCK

Protein Name :

Circadian locomoter output cycles protein kaput

Gene Full Name :

clock circadian regulator

Synonyms :

bHLHe8 antibody Circadian locomoter output cycles kaput protein antibody Circadian locomoter output cycles protein kaput antibody Circadian Locomotor Output Cycles Kaput antibody Circadium Locomotor Output Cycles Kaput antibody Class E basic helix-loop-helix protein 8 antibody CLOCK antibody Clock circadian regulator antibody Clock homolog antibody Clock protein antibody CLOCK_HUMAN antibody hCLOCK antibody KIAA0334 antibody

Uniprot ID :

O15516

more info or order :

Boster Immunoleader product webpage