product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-Osteopontin Antibody
catalog :
RP1080
quantity :
100 ug/vial
price :
200 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot, ELISA
more info or order :
product information
Product Name :
Anti-Osteopontin Antibody
Catalog Number :
RP1080
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Osteopontin(SPP1) detection. Tested with WB, ELISA in Human;Mouse;Rat.
Price :
200 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB,ELISA
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat
ELISA :
Concentration: 0.1-0.5μg/ml; Tested Species: Human
Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Osteopontin (281-314aa HEDMLVVDPKSKEEDKHLKFRISHELDSASSEVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
Osteopontin (OPN), also known as secreted phosphoprotein 1 (SPP1), is a protein that in humans is encoded by the SPP1 gene (secreted phosphoprotein 1). The protein encoded by this gene is involved in the attachment of osteoclasts to the mineralized bone matrix. And the encoded protein is secreted and binds hydroxyapatite with high affinity. The osteoclast vitronectin receptor is found in the cell membrane and may be involved in the binding to this protein. Also, this protein is a cytokine that upregulates expression of interferon-gamma and interleukin-12. Several transcript variants encoding different isoforms have been found for this gene.
Reference :
1. "Entrez Gene: SPP1 secreted phosphoprotein 1".
2. Reinholt FP, Hultenby K, Oldberg A, Heinegård D (June 1990). "Osteopontin--a possible anchor of osteoclasts to bone". Proc. Natl. Acad. Sci. U.S.A. 87 (12): 4473–5.
3. Wang KX, Denhardt DT (2008). "Osteopontin: role in immune regulation and stress responses". Cytokine Growth Factor Rev. 19 (5-6): 333–45.
Gene Name :
SPP1
Protein Name :
Osteopontin
Gene Full Name :
secreted phosphoprotein 1
Synonyms :
BNSP antibody Bone sialoprotein 1 antibody BSP I antibody BSPI antibody Early T lymphocyte activation 1 antibody ETA 1 antibody ETA1 antibody MGC110940 antibody Nephropontin antibody OPN antibody Osteopontin antibody osteopontin/immunoglobulin alpha 1 heavy chain constant region fusion protein antibody OSTP_HUMAN antibody PSEC0156 antibody secreted phosphoprotein 1 (osteopontin, bone sialoprotein I, early T-lymphocyte activation 1) antibody Secreted phosphoprotein 1 antibody SPP 1 antibody SPP-1 antibody SPP1 antibody SPP1/CALPHA1 fusion antibody Urinary stone protein antibody Uropontin antibody
Uniprot ID :
P10451
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments