product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-TSG101 Antibody
catalog :
RP1078
quantity :
100 ug/vial
price :
200 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, rat
application :
western blot
more info or order :
product information
Product Name :
Anti-TSG101 Antibody
Catalog Number :
RP1078
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Tumor susceptibility gene 101 protein(TSG101) detection. Tested with WB in Human;Rat.
Price :
200 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat
Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human TSG101 (361-390aa KHVRLLSRKQFQLRALMQKARKTAGLSDLY), identical to the related mouse and rat sequences.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
TSG101, known as Tumor susceptibility gene 101, is mapped to 11p15. The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. And the protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.
Reference :
1. "Entrez Gene: TSG101 tumor susceptibility gene 101".
2. Lu Q, Hope LW, Brasch M, Reinhard C, Cohen SN (June 2003). "TSG101 interaction with HRS mediates endosomal trafficking and receptor down-regulation".Proc. Natl. Acad. Sci. U.S.A. 100 (13): 7626–31.
3. Sun Z, Pan J, Hope WX, Cohen SN, Balk SP (August 1999). "Tumor susceptibility gene 101 protein represses androgen receptor transactivation and interacts with p300". Cancer 86 (4): 689–96.
Gene Name :
TSG101
Protein Name :
Tumor susceptibility gene 101 protein
Gene Full Name :
tumor susceptibility 101
Synonyms :
ESCRT I complex subunit TSG101 antibody ESCRT-I complex subunit TSG101 antibody TS101_HUMAN antibody TSG 10 antibody TSG 101 antibody TSG10 antibody Tsg101 antibody Tumor susceptibility gene 10 antibody Tumor susceptibility gene 101 antibody Tumor susceptibility gene 101 protein antibody Tumor susceptibility protein antibody Tumor susceptibility protein isoform 3 antibody VPS 23 antibody VPS23 antibody
Uniprot ID :
Q99816
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
browse more products
questions and comments
