product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-JNK2 Antibody
catalog :
RP1077
quantity :
100 ug/vial
price :
200 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot
product information
Product Name :
Anti-JNK2 Antibody
Catalog Number :
RP1077
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Mitogen-activated protein kinase 9(MAPK9) detection. Tested with WB in Human.
Price :
200 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human
Notes :
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence in the middle region of human JNK2 (257-288aa RNYVENRPKYPGIKFEELFPDWIFPSESERDK), identical to the related mouse and rat sequences.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
JNK2 is also known as MAPK9. The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase targets specific transcription factors, and thus mediates immediate-early gene expression in response to various cell stimuli. It is most closely related to MAPK8, both of which are involved in UV radiation induced apoptosis, thought to be related to the cytochrome c-mediated cell death pathway. Also, this gene and MAPK8 are also known as c-Jun N-terminal kinases. This kinase blocks the ubiquitination of tumor suppressor p53, and thus it increases the stability of p53 in nonstressed cells. Studies of this gene's mouse counterpart suggest a key role in T-cell differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.
Reference :
1. Raciti M; Lotti LV; Valia S; Pulcinelli FM; Di Renzo L. “JNK2 is activated during ER stress and promotes cell survival”. Cell Death Dis, 2012 Nov 22. 2. Wang P; Xiong Y; Ma C; Shi T; Ma D. “Molecular cloning and characterization of novel human JNK2 (MAPK9) transcript variants that show different stimulation activities on AP-1”. BMB Rep, 2010 Nov.
Gene Name :
MAPK9
Protein Name :
Mitogen-activated protein kinase 9
Gene Full Name :
mitogen-activated protein kinase 9
Synonyms :
c Jun kinase 2 antibody C Jun N terminal kinase 2 antibody c-Jun N-terminal kinase 2 antibody JNK 55 antibody JNK-55 antibody JNK2 alpha antibody JNK2 antibody JNK2 beta antibody JNK2A antibody JNK2alpha antibody JNK2B antibody JNK2BETA antibody Jun kinase antibody MAP kinase 9 antibody MAPK 9 antibody Mapk9 antibody Mitogen activated protein kinase 9 antibody Mitogen-activated protein kinase 9 antibody MK09_HUMAN antibody P54a antibody p54aSAPK antibody PRKM9 antibody SAPK alpha antibody SAPK antibody SAPK1a antibody Stress activated protein kinase 1a antibody Stress-activated protein kinase JNK2 antibody
Uniprot ID :
P45984
company information
Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits