product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-SP1 Antibody
catalog :
RP1072
quantity :
100 ug/vial
price :
200 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot
more info or order :
product information
Product Name :
Anti-SP1 Antibody
Catalog Number :
RP1072
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Transcription factor Sp1(SP1) detection. Tested with WB in Human.
Price :
200 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human
Notes :
WB: The detection limit for SP1 is approximately 0.1ng/lane under reducing conditions.
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human SP1 (752-785aa EAICPEGIARLANSGINVMQVADLQSINISGNGF), different from the related mouse and rat sequences by two amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
SP1(transcription factor Sp1), also known as Specificity Protein 1, is a human transcription factor involved in gene expression in the early development of an organism. It belongs to the Sp/KLF family of transcription factors. The protein is 785 amino acids long, with a molecular weight of 81 kDA. By fluorescence in situ hybridization, Matera and Ward (1993) mapped the SP1 gene to 12q13. By in situ hybridization, Gaynor et al. (1993) concluded that 12q13.1 is the most probable location of the SP1 gene. Segmentation in Drosophila is based on a cascade of hierarchical gene interactions initiated by maternally deposited morphogens that define the spatially restricted domains of gap gene expression at blastoderm. The formation of 7 head segments depends on the function of several genes. Wimmer et al. (1993) showed that one of these genes is the Drosophila homolog of the human transcription factor SP1.
Reference :
1. Gaynor, R. B., Shieh, B.-H., Klisak, I., Sparkes, R. S., Lusis, A. J.Localization of the transcription factor SP1 gene to human chromosome 12q12-q13.2.Cytogenet. Cell Genet. 64: 210-212, 1993.
2. Matera, A. G., Ward, D. C.Localization of the human Sp1 transcription factor gene to 12q13 by fluorescence in situ hybridization.Genomics 17: 793-794, 1993.
3. Wimmer, E. A., Jackle, H., Pfeifle, C., Cohen, S. M.A Drosophila homologue of human Sp1 is a head-specific segmentation gene.Nature 366: 690-694, 1993.Wimmer, E. A., Jackle, H., Pfeifle, C., Cohen, S. M.A Drosophila homologue of human Sp1 is a head-specific segmentation gene.Nature 366: 690-694, 1993.
Gene Name :
SP1
Protein Name :
Transcription factor Sp1
Gene Full Name :
Sp1 transcription factor
Synonyms :
SP 1 antibody SP1 antibody Sp1 transcription factor antibody SP1_HUMAN antibody Specificity protein 1 antibody Transcription factor Sp1 antibody TSFP 1 antibody TSFP1 antibody
Uniprot ID :
P08047
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
related products
browse more products
questions and comments