Anti-CDK5R1 Antibody | Boster Immunoleader RP1060 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-CDK5R1 Antibody

catalog :

RP1060

quantity :

100 ug/vial

price :

200 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human

application :

western blot

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-CDK5R1 Antibody

Catalog Number :

RP1060

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Cyclin-dependent kinase 5 activator 1(CDK5R1) detection. Tested with WB in Human.

Price :

200 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human

Applications :

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human

Notes :

WB: The detection limit for CDK5R1 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human CDK5R1 (11-44aa YRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRH), identical to the related mouse and rat sequences.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

CDK5R1 is also known as p35, CDK5R or NCK5A. The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease.

Reference :

1. Schizophrenia is associated with dysregulation of a Cdk5 activator that regulates synaptic protein expression and cognition.Engmann O, et al. Brain, 2011 Aug. 2. Cdk5/p35 is required for motor coordination and cerebellar plasticity.He X, et al. J Neurochem, 2014 Oct. 3. CDK5 and its activator P35 in normal pituitary and in pituitary adenomas: relationship to VEGF expression.Xie W, et al. Int J Biol Sci, 2014.

Gene Name :

CDK5R1

Protein Name :

Cyclin-dependent kinase 5 activator 1

Gene Full Name :

cyclin-dependent kinase 5, regulatory subunit 1 (p35)

Synonyms :

CD5R1_HUMAN antibody CDK 5R1 antibody CDK5 activator 1 antibody CDK5P35 antibody CDK5R antibody CDK5R1 antibody Cyclin dependent kinase 5 activator 1 antibody Cyclin dependent kinase 5 regulatory subunit 1 antibody Cyclin-dependent kinase 5 activator 1 antibody Cyclin-dependent kinase 5 regulatory subunit 1 antibody MGC33831 antibody NCK 5A antibody NCK5A antibody Neuronal CDK5 activator antibody p23 antibody p25 antibody p25 included antibody p35 antibody p35nck5a antibody Regulatory partner for CDK5 kinase antibody Tau protein kinase II 23 kDa subunit antibody Tau protein kinase II 23kDa subunit antibody TPKII regulatory subunit antibody

Uniprot ID :

Q15078

more info or order :

Boster Immunoleader product webpage