product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-CDK5R1 Antibody
catalog :
RP1060
quantity :
100 ug/vial
price :
200 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human
application :
western blot
product information
Product Name :
Anti-CDK5R1 Antibody
Catalog Number :
RP1060
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Cyclin-dependent kinase 5 activator 1(CDK5R1) detection. Tested with WB in Human.
Price :
200 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human
Notes :
WB: The detection limit for CDK5R1 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human CDK5R1 (11-44aa YRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRH), identical to the related mouse and rat sequences.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
CDK5R1 is also known as p35, CDK5R or NCK5A. The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease.
Reference :
1. Schizophrenia is associated with dysregulation of a Cdk5 activator that regulates synaptic protein expression and cognition.Engmann O, et al. Brain, 2011 Aug. 2. Cdk5/p35 is required for motor coordination and cerebellar plasticity.He X, et al. J Neurochem, 2014 Oct. 3. CDK5 and its activator P35 in normal pituitary and in pituitary adenomas: relationship to VEGF expression.Xie W, et al. Int J Biol Sci, 2014.
Gene Name :
CDK5R1
Protein Name :
Cyclin-dependent kinase 5 activator 1
Gene Full Name :
cyclin-dependent kinase 5, regulatory subunit 1 (p35)
Synonyms :
CD5R1_HUMAN antibody CDK 5R1 antibody CDK5 activator 1 antibody CDK5P35 antibody CDK5R antibody CDK5R1 antibody Cyclin dependent kinase 5 activator 1 antibody Cyclin dependent kinase 5 regulatory subunit 1 antibody Cyclin-dependent kinase 5 activator 1 antibody Cyclin-dependent kinase 5 regulatory subunit 1 antibody MGC33831 antibody NCK 5A antibody NCK5A antibody Neuronal CDK5 activator antibody p23 antibody p25 antibody p25 included antibody p35 antibody p35nck5a antibody Regulatory partner for CDK5 kinase antibody Tau protein kinase II 23 kDa subunit antibody Tau protein kinase II 23kDa subunit antibody TPKII regulatory subunit antibody
Uniprot ID :
Q15078
company information
Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits