Boster Immunoleader

antibody

Anti-ATP2A3 Antibody

RP1055

100 ug/vial

200 USD

polyclonal

rabbit

western blot, immunohistochemistry - paraffin section

Anti-ATP2A3 Antibody

RP1055

Polyclonal

Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 3(ATP2A3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

200 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: mouse, rat Predicted to work with: human

WB,IHC-P

Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Concentration: 0.5-1μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A3(1-30aa MEAAHLLPAADVLRHFSVTAEGGLSPAQVT), different from the related mouse sequence by five amino acids, and from the related rat sequence by six amino acids.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, also known as SERCA3, is anenzyme that in humans is encoded by the ATP2A3 gene. It is mapped to 17p13.2. This gene encodes one of the SERCA Ca2+-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells. ATP2A3 expression was originally described as non-muscular, but was recently observed in cardiomyocyte. What’s more, the expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.

1. Dode L, Wuytack F, Kools PF, Baba-Aissa F, Raeymaekers L, Brike F, van de Ven WJ, Casteels R (Nov 1996). 2. Gelebart, P., Kovacs, T., Brouland, J.-P., van Gorp, R., Grossmann, J., Rivard, N., Panis, Y., Martin, V., Bredoux, R., Enouf, J., Papp, B. Expression of endomembrane calcium pumps in colon and gastric cancer cells: induction of SERCA3 expression during differentiation. J. Biol. Chem. 277: 26310-26320, 2002.

ATP2A3

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3

ATPase, Ca++ transporting, ubiquitous

Adenosine triphosphatase calcium antibody AT2A3_HUMAN antibody ATP2A3 antibody ATPase Ca(2+) transporting ubiquitous antibody ATPase Ca++ transporting ubiquitous antibody Calcium pump 3 antibody Calcium translocating P type ATPase antibody Sarco/endoplasmic reticulum Ca2+ ATPase antibody Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 antibody SERCA 3 antibody SERCA3 antibody SERCA3b antibody SR Ca(2+) ATPase 3 antibody SR Ca(2+)-ATPase 3 antibody

Q93084