Boster Immunoleader

antibody

Anti-ATP2A2 Antibody

RP1054

100 ug/vial

200 USD

polyclonal

rabbit

western blot, immunohistochemistry - paraffin section

Anti-ATP2A2 Antibody

RP1054

Polyclonal

Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 (ATP2A2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

200 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: mouse, rat Predicted to work with: human

WB,IHC-P

Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Concentration: 0.5-1μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A2(1-32aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL), identical to the related mouse and rat sequences.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca(2+)-ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles; germinative and mature cells of sebaceous glands; secretory coil and duct of eccrine glands; apocrine gland cells; and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells.

1. Ahn, W., Lee, M. G., Kim, K. H., Muallem, S. Multiple effects of SERCA2b mutations associated with Darier's disease. J. Biol. Chem. 278: 20795-20801, 2003. 2. Berk, D. R., Taube, J. M., Bruckner, A. L., Lane, A. T. A sporadic patient with acrokeratosis verruciformis of Hopf and a novel ATP2A2 mutation. (Letter) Brit. J. Derm. 163: 653-654, 2010. 3. Chao, S.-C., Yang, M.-H., Lee, J. Y.-Y. Mutation analysis of the ATP2A2 gene in Taiwanese patients with Darier's disease. Brit. J. Derm. 146: 958-963, 2002.

ATP2A2

Sarcoplasmic/endoplasmic reticulum calcium ATPase 2

ATPase, Ca++ transporting, cardiac muscle, slow twitch 2

AT2A2_HUMAN antibody ATP2A2 antibody ATP2B antibody ATPase Ca++ transporting cardiac muscle slow twitch 2 antibody Calcium pump 2 antibody Calcium-transporting ATPase sarcoplasmic reticulum type antibody Calcium-transporting ATPase sarcoplasmic reticulum type slow twitch skeletal muscle isoform antibody Cardiac Ca2+ ATPase antibody DAR antibody DD antibody Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody MGC45367 antibody Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 antibody SERCA 2 antibody SERCA2 antibody serca2a antibody slow twitch skeletal muscle isoform antibody SR Ca(2+)-ATPase 2 antibody

P16615