Anti-ATP2A1 Antibody | Boster Immunoleader RP1053 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-ATP2A1 Antibody

catalog :

RP1053

quantity :

100 ug/vial

price :

200 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-ATP2A1 Antibody

Catalog Number :

RP1053

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Price :

200 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: mouse, rat Predicted to work with: human

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Mouse, Rat; Predicted Species: Human

Notes :

Tested Species: In-house tested species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A1 (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN), different from the related mouse and rat sequences by three amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.

Reference :

1. Brandl, C. J., Green, N. M., Korczak, B., MacLennan, D. H. Two Ca(2+) ATPase genes: homologies and mechanistic implications of deduced amino acid sequences. Cell 44: 597-607, 1986. 2. Karpati, G., Charuk, J., Carpenter, S., Jablecki, C., Holland, P. Myopathy caused by a deficiency of Ca(2+)-adenosine triphosphatase in sarcoplasmic reticulum (Brody's disease). Ann. Neurol. 20: 38-49, 1986. 3. Zhang, Y., Fujii, J., Phillips, M. S., Chen, H.-S., Karpati, G., Yee, W.-C., Schrank, B., Cornblath, D. R., Boyland, K. B., MacLennan, D. H. Characterization of cDNA and genomic DNA encoding SERCA1, the Ca(2+)-ATPase of human fast-twitch skeletal muscle sarcoplasmic reticulum, and its elimination as a candidate gene for Brody disease. Gemomics 30: 415-424, 1995.

Gene Name :

ATP2A1

Protein Name :

Sarcoplasmic/endoplasmic reticulum calcium ATPase 1

Gene Full Name :

ATPase, Ca++ transporting, cardiac muscle, fast twitch 1

Synonyms :

fast twitch skeletal muscle isoform antibody AT2A1_HUMAN antibody ATP2A antibody ATP2A1 antibody ATPase Ca++ transporting cardiac muscle fast twitch 1 antibody ATPase Ca++ transporting fast twitch 1 antibody ATPase, Ca(2+)-transporting fast twitch 1 antibody Calcium pump 1 antibody Calcium transporting ATPase sarcoplasmic reticulum type fast twitch skeletal muscle isoform antibody Calcium-transporting ATPase sarcoplasmic reticulum type antibody Endoplasmic reticulum class 1/2 Ca(2+) ATPase antibody Fast skeletal muscle SR calcium ATPase antibody OTTHUMP00000162561 antibody OTTHUMP00000162562 antibody Sarcoendoplasmic reticulum calcium ATPase antibody Sarcoplasmic reticulum Ca(2+)-ATPase 1 antibody Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 antibody SERCA 1 antibody SERCA1 antibody SERCA1 truncated isoform, included antibody SR Ca(2+) ATPase 1 antibody SR Ca(2+)-ATPase 1 antibody

Uniprot ID :

O14983

more info or order :

Boster Immunoleader product webpage