Anti-P Glycoprotein Antibody | Boster Immunoleader RP1034 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-P Glycoprotein Antibody

catalog :

RP1034

quantity :

100 ug/vial

price :

200 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, mouse, rat

application :

immunohistochemistry - paraffin section, immunohistochemistry - frozen section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-P Glycoprotein Antibody

Catalog Number :

RP1034

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Multidrug resistance protein 1(ABCB1) detection. Tested with IHC-P, IHC-F in Human;Mouse;Rat.

Price :

200 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse, rat

Applications :

IHC-P,IHC-F

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human, Mouse, Rat

Immunohistochemistry(Frozen Section) :

Concentration: 0.5-1μg/ml; Tested Species: Mouse, Rat

Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human P Glycoprotein(621-650aa IYFKLVTMQTAGNEVELENAADESKSEIDA), different from the related rat sequence by twelve amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by SA1022 in IHC(P) and IHC(F).

Background :

P-GP, also called ABCB1 or PGY1, is a glycoprotein that in humans is encoded by the ABCB1 gene. It is mapped to 7q21.12. P-GP is a well-characterized ABC-transporter (which transports a wide variety of substrates across extra- and intracellular membranes) of the MDR/TAP subfamily. It is an important protein of the cell membrane that pumps many foreign substances out of cells. More formally, it is an ATP-dependent drug efflux pump with broad substrate specificity. P-GP is an ATP-dependent drug efflux pump forxenobiotic compounds with broad substrate specificity. It is responsible for decreased drug accumulation in multidrug-resistant cells and often mediates the development of resistance to anticancer drugs. This protein also functions as a transporter in the blood–brain barrier.

Reference :

1. Aller SG, Yu J, Ward A, Weng Y, Chittaboina S, Zhuo R, Harrell PM, Trinh YT, Zhang Q, Urbatsch IL, Chang G (March 2009). 2. Ueda K, Clark DP, Chen CJ, Roninson IB,Gottesman MM, Pastan I (January 1987). "The human multidrug resistance (mdr1) gene. cDNA cloning and transcription initiation". J. Biol. Chem.262 (2): 505–8.

Gene Name :

ABCB1

Protein Name :

Multidrug resistance protein 1

Gene Full Name :

ATP-binding cassette, sub-family B (MDR/TAP), member 1

Synonyms :

ABC20 antibody ABCB1 antibody ATP binding cassette, sub family B (MDR/TAP), member 1 antibody ATP-binding cassette sub-family B member 1 antibody CD243 antibody CLCS antibody Colchicin sensitivity antibody Doxorubicin resistance antibody GP170 antibody MDR1 antibody MDR1_HUMAN antibody Multidrug resistance 1 antibody Multidrug resistance protein 1 antibody P glycoprotein 1 antibody P gp antibody P-glycoprotein 1 antibody PGY1 antibody

Uniprot ID :

P08183

more info or order :

Boster Immunoleader product webpage