product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-p95 NBS1 Antibody
catalog :
PB9615
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry - paraffin section
more info or order :
product information
Product Name :
Anti-p95 NBS1 Antibody
Catalog Number :
PB9615
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Nibrin(NBN) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, mouse, rat
Applications :
WB,IHC-P
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat
Immunohistochemistry(Paraffin-embedded S ... :
Concentration: 0.5-1μg/ml; Tested Species: Human
Notes :
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human p95 NBS1 (714-745aa RKNTELEEWLRQEMEVQNQHAKEESLADDLFR), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).
Background :
p95 NBS1, also known as NBN or Nibrin, is a protein which in humans is encoded by the NBN gene. Nibrin is a protein associated with the repair of double strand breaks (DSBs) which pose serious damage to a genome. It is a 754 amino acid protein identified as a member of the NBS1/hMre11/RAD50(N/M/R, more commonly referred to asMRN) double strand DNA break repair complex. This complex recognizes DNA damage and rapidly relocates to DSB sites and forms nuclear foci. It also has a role in regulation of N/M/R (MRN) protein complex activity which includes end-processing of both physiological and mutagenic DNA double strand breaks (DSBs).
Reference :
1. "Atlas of Genetics and Cytogenetics in Oncology and Haematology - NBS1".
2. Carney JP, Maser RS, Olivares H, Davis EM, Le Beau M, Yates JR, Hays L, Morgan WF, Petrini JH (May 1998). "The hMre11/hRad50 protein complex and Nijmegen breakage syndrome: linkage of double-strand break repair to the cellular DNA damage response". Cell 93 (3): 477–86.
3. Varon R, Vissinga C, Platzer M, Cerosaletti KM, Chrzanowska KH, Saar K, Beckmann G, Seemanová E, Cooper PR, Nowak NJ, Stumm M, Weemaes CM, Gatti RA, Wilson RK, Digweed M, Rosenthal A, Sperling K, Concannon P, Reis A (May 1998). "Nibrin, a novel DNA double-strand break repair protein, is mutated in Nijmegen breakage syndrome". Cell 93 (3): 467–76.
Gene Name :
NBN
Protein Name :
Nibrin
Gene Full Name :
nibrin
Synonyms :
AT V1 antibody AT V2 antibody ATV antibody ATV antibody Cell cycle regulatory protein p95 antibody FLJ10155 antibody MGC87362 antibody NBN antibody NBN_HUMAN antibody NBS 1 antibody NBS antibody NBS antibody NBS1 antibody Nibrin antibody Nibrin antibody Nijmegen breakage syndrome 1 (nibrin) antibody Nijmegen breakage syndrome antibody Nijmegen breakage syndrome protein 1 antibody p95 antibody p95 antibody p95 protein of the MRE11/RAD50 complex antibody
Uniprot ID :
O60934
more info or order :
company information

Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
