Boster Immunoleader

antibody

Anti-p95 NBS1 Antibody

PB9615

100 ug/vial

240 USD

polyclonal

rabbit

human, mouse, rat

western blot, immunohistochemistry - paraffin section

Anti-p95 NBS1 Antibody

PB9615

Polyclonal

Rabbit IgG polyclonal antibody for Nibrin(NBN) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

240 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: human, mouse, rat

WB,IHC-P

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat

Concentration: 0.5-1μg/ml; Tested Species: Human

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence at the C-terminus of human p95 NBS1 (714-745aa RKNTELEEWLRQEMEVQNQHAKEESLADDLFR), different from the related mouse sequence by three amino acids, and from the related rat sequence by five amino acids.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

p95 NBS1, also known as NBN or Nibrin, is a protein which in humans is encoded by the NBN gene. Nibrin is a protein associated with the repair of double strand breaks (DSBs) which pose serious damage to a genome. It is a 754 amino acid protein identified as a member of the NBS1/hMre11/RAD50(N/M/R, more commonly referred to asMRN) double strand DNA break repair complex. This complex recognizes DNA damage and rapidly relocates to DSB sites and forms nuclear foci. It also has a role in regulation of N/M/R (MRN) protein complex activity which includes end-processing of both physiological and mutagenic DNA double strand breaks (DSBs).

1. "Atlas of Genetics and Cytogenetics in Oncology and Haematology - NBS1". 2. Carney JP, Maser RS, Olivares H, Davis EM, Le Beau M, Yates JR, Hays L, Morgan WF, Petrini JH (May 1998). "The hMre11/hRad50 protein complex and Nijmegen breakage syndrome: linkage of double-strand break repair to the cellular DNA damage response". Cell 93 (3): 477–86. 3. Varon R, Vissinga C, Platzer M, Cerosaletti KM, Chrzanowska KH, Saar K, Beckmann G, Seemanová E, Cooper PR, Nowak NJ, Stumm M, Weemaes CM, Gatti RA, Wilson RK, Digweed M, Rosenthal A, Sperling K, Concannon P, Reis A (May 1998). "Nibrin, a novel DNA double-strand break repair protein, is mutated in Nijmegen breakage syndrome". Cell 93 (3): 467–76.

NBN

Nibrin

nibrin

AT V1 antibody AT V2 antibody ATV antibody ATV antibody Cell cycle regulatory protein p95 antibody FLJ10155 antibody MGC87362 antibody NBN antibody NBN_HUMAN antibody NBS 1 antibody NBS antibody NBS antibody NBS1 antibody Nibrin antibody Nibrin antibody Nijmegen breakage syndrome 1 (nibrin) antibody Nijmegen breakage syndrome antibody Nijmegen breakage syndrome protein 1 antibody p95 antibody p95 antibody p95 protein of the MRE11/RAD50 complex antibody

O60934