Anti-MICA Antibody | Boster Immunoleader PB9612 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-MICA Antibody

catalog :

PB9612

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human

application :

western blot

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-MICA Antibody

Catalog Number :

PB9612

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for MHC class I polypeptide-related sequence A(MICA) detection. Tested with WB in Human.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human

Applications :

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human

Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human MICA (304-334aa QSHWQTFHVSAVAAAAKFVEIIFYVRCCKKK).

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

This gene encodes the highly polymorphic major histocompatability complex class I chain-related protein A. The protein product is expressed on the cell surface, although unlike canonical class I molecules it does not seem to associate with beta-2-microglobulin. It is a ligand for the NKG2-D type II integral membrane protein receptor. And the protein functions as a stress-induced antigen that is broadly recognized by intestinal epithelial gamma delta T cells. Variations in this gene have been associated with susceptibility to psoriasis 1 and psoriatic arthritis, and the shedding of MICA-related antibodies and ligands is involved in the progression from monoclonal gammopathy of undetermined significance to multiple myeloma. Alternative splicing of this gene results in multiple transcript variants.

Reference :

1. Bahram S, Bresnahan M, Geraghty DE, Spies T (Aug 1994). "A second lineage of mammalian major histocompatibility complex class I genes". Proc Natl Acad Sci U S A 91 (14): 6259–63. 2. "Entrez Gene: MICA MHC class I polypeptide-related sequence A". 3. González, S et al. (2008). "NKG2D ligands: key targets of the immune response". Trends in Immunology 29 (8).

Gene Name :

MICA

Protein Name :

MHC class I polypeptide-related sequence A

Gene Full Name :

MHC class I polypeptide-related sequence A

Synonyms :

HLA class I antigen antibody FLJ36918 antibody FLJ60820 antibody MGC111087 antibody MGC21250 antibody MHC class I chain related gene A protein antibody MHC class I chain related protein A antibody MHC class I chain related protein A HLA B HLA C antibody MHC class I polypeptide related sequence A antibody MHC class I polypeptide-related sequence A antibody MHC class I related protein antibody MIC A antibody MIC-A antibody micA antibody MICA_HUMAN antibody OTTHUMP00000029088 antibody OTTHUMP00000044528 antibody OTTHUMP00000165170 antibody OTTHUMP00000165172 antibody PERB11.1 antibody Stress inducible class I homolog antibody

Uniprot ID :

Q29983

more info or order :

Boster Immunoleader product webpage