product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-IGFBP1 Antibody
catalog :
PB9604
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
mouse, rat
application :
western blot, ELISA
product information
Product Name :
Anti-IGFBP1 Antibody
Catalog Number :
PB9604
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Insulin-like growth factor-binding protein 1(IGFBP1) detection. Tested with WB, ELISA in Mouse;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: mouse, rat
Applications :
WB,ELISA
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Mouse, Rat
ELISA :
Concentration: 0.1-0.5μg/ml; Tested Species: Mouse
Notes :
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of mouse IGFBP1 (177-207aa REIADLKKWKEPCQRELYKVLERLAAAQQKA), different from the related human sequence by eleven amino acids, and from the related rat sequence by one amino acid.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
IGFBP1, Insulin-like growth factor-binding protein 1, also known as placental protein 12 (PP12), is a protein that in humans is encoded by the IGFBP1 gene. The IGFBP1 gene has 4 exons and spans 5.9 kb. And the IGFBP1gene is localized to 7p13-p12 by in situ hybridization. This gene is a member of the Insulin-like growth factor-binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a type-I thyroglobulin domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Reference :
1. Alitalo, T., Kontula, K., Koistinen, R., Aalto-Setala, K., Julkunen, M., Janne, O. A., Seppala, M., de la Chapelle, A.The gene encoding human low-molecular weight insulin-like growth-factor binding protein (IGF-BP25): regional localization to 7p12-p13 and description of a DNA polymorphism.Hum. Genet. 83: 335-338, 1989. 2. Brinkman, A., Groffen, C. A. H., Kortleve, D. J., Drop, S. L. S.Organization of the gene encoding the insulin-like growth factor binding protein IBP-1.Biochem. Biophys. Res. Commun. 157: 898-907, 1988. 3. Leu, J. I.-J., George, D. L.Hepatic IGFBP1 is a prosurvival factor that binds to BAK, protects the liver from apoptosis, and antagonizes the proapoptotic actions of p53 at mitochondria.Genes Dev. 21: 3095-3109, 2007.
Gene Name :
IGFBP1
Protein Name :
Insulin-like growth factor-binding protein 1
Gene Full Name :
insulin-like growth factor binding protein 1
Synonyms :
AFBP antibody Alpha pregnancy associated endometrial globulin antibody Amniotic fluid binding protein antibody Binding protein 25 antibody Binding protein 26 antibody Binding protein 28 antibody Growth hormone independent binding protein antibody hIGFBP 1 antibody hIGFBP1 antibody IBP 1 antibody IBP-1 antibody IBP1 antibody IBP1_HUMAN antibody IGF binding protein 1 antibody IGF BP25 antibody IGF-binding protein 1 antibody IGFBP 1 antibody IGFBP-1 antibody IGFBP1 antibody Insulin Like Growth Factor Binding Protein 1 antibody Insulin-like growth factor-binding protein 1 antibody Placental protein 12 antibody PP 12 antibody PP12 antibody
Uniprot ID :
P47876
company information
Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits