Anti-IDO1 Antibody | Boster Immunoleader PB9603 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-IDO1 Antibody

catalog :

PB9603

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry - paraffin section

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-IDO1 Antibody

Catalog Number :

PB9603

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for Indoleamine 2,3-dioxygenase 1(IDO1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, mouse, rat

Applications :

WB,IHC-P

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat

Immunohistochemistry(Paraffin-embedded S ... :

Concentration: 0.5-1μg/ml; Tested Species: Human

Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human IDO1 (37-69aa NDWMFIAKHLPDLIESGQLRERVEKLNMLSIDH), different from the related mouse sequence by fourteen amino acids, and from the related rat sequence by seventeen amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Background :

IDO1 (INDOLEAMINE 2,3-DIOXYGENASE), INDO or IDO, is an immunomodulatory enzyme produced by some alternatively activated macrophages and other immunoregulatory cells. This enzyme catalyzes the degradation of the essential amino acid L-tryptophan to N-formyl-kynurenine. By fluorescence in situ hybridization, the assignment is narrowed to chromosome 8p12-p11. INDO Interferon-gamma has an antiproliferative effect on many tumor cells and inhibits intracellular pathogens such as Toxoplasma and chlamydia, at least partly because of the induction of indoleamine 2,3-dioxygenase. During inflammation, IDO is upregulated in dendritic cells and phagocytes by proinflammatory stimuli, most notably IFNG, and the enzyme then uses superoxide as a 'cofactor' for oxidative cleavage of the indole ring of tryptophan, yielding an intermediate that deformylates to L-kynurenine.

Reference :

1. Burkin, D. J., Kimbro, K. S., Barr, B. L., Jones, C., Taylor, M. W., Gupta, S. L. Localization of the human indoleamine 2,3-dioxygenase (IDO) gene to the pericentromeric region of human chromosome 8. Genomics 17: 262-263, 1993. 2. Dai, W., Gupta, S. L. Molecular cloning, sequencing and expression of human interferon-gamma-inducible indoleamine 2,3-dioxygenase cDNA. Biochem. Biophys. Res. Commun. 168: 1-8, 1990. 3. Fallarino, F., Grohmann, U., Hwang, K. W., Orabona, C., Vacca, C., Bianchi, R., Belladonna, M. L., Fioretti, M. C., Alegre, M.-L., Puccetti, P. Modulation of tryptophan catabolism by regulatory T cells. Nature Immun. 4: 1206-1212, 2003.

Gene Name :

IDO1

Protein Name :

Indoleamine 2,3-dioxygenase 1

Gene Full Name :

indoleamine 2,3-dioxygenase 1

Synonyms :

3-dioxygenase antibody I23O1_HUMAN antibody IDO 1 antibody IDO antibody IDO-1 antibody IDO1 antibody INDO antibody indolamine 2,3 dioxygenase antibody Indole 2 3 dioxygenase antibody indoleamine 2 3 dioxygenase 1 antibody indoleamine 2 3 dioxygenase antibody Indoleamine 2,3-dioxygenase 1 antibody Indoleamine pyrrole 2 3 dioxygenase antibody Indoleamine-pyrrole 2 antibody

Uniprot ID :

P14902

more info or order :

Boster Immunoleader product webpage