Boster Immunoleader

antibody

Anti-IDH1 Antibody

PB9601

100 ug/vial

240 USD

polyclonal

rabbit

human, mouse, rat

western blot, immunohistochemistry - paraffin section

Anti-IDH1 Antibody

PB9601

Polyclonal

Rabbit IgG polyclonal antibody for Isocitrate dehydrogenase [NADP] cytoplasmic(IDH1) detection. Tested with WB, IHC-P in Human;Mouse; Rat.

240 USD

Rabbit IgG

100 ug/vial

Lyophilized

No cross reactivity with other proteins.

Reacts with: human, mouse, rat

WB,IHC-P

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Mouse, Rat

Concentration: 0.5-1μg/ml; Tested Species: Human, Mouse, Rat

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid.

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB, supported by SA1022 in IHC(P).

Isocitrate dehydrogenase 1 (NADP+), soluble is an enzyme that in humans is encoded by the IDH1 gene. Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production. Alternatively spliced transcript variants encoding the same protein have been found for this gene.

1. "Entrez Gene: Isocitrate dehydrogenase 1 (NADP+), soluble". 2. Watanabe T, Nobusawa S, Kleihues P, Ohgaki H (April 2009). "IDH1 mutations are early events in the development of astrocytomas and oligodendrogliomas.". Am J Pathol. 174 issue = 4 (4): 1149–53.

IDH1

Isocitrate dehydrogenase [NADP] cytoplasmic

isocitrate dehydrogenase 1 (NADP+), soluble

Cytosolic NADP isocitrate dehydrogenase antibody Cytosolic NADP-isocitrate dehydrogenase antibody Epididymis luminal protein 216 antibody Epididymis secretory protein Li 26 antibody HEL-216 antibody HEL-S-26 antibody ICDH antibody IDCD antibody IDH antibody IDH1 antibody IDHC_HUMAN antibody IDP antibody IDPC antibody Isocitrate dehydrogenase [NADP] cytoplasmic antibody Isocitrate dehydrogenase 1 (NADP+) soluble antibody NADP dependent isocitrate dehydrogenase cytosolic antibody NADP dependent isocitrate dehydrogenase peroxisomal antibody NADP(+)-specific ICDH antibody Oxalosuccinate decarboxylase antibody PICD antibody

O75874