Anti-5HT2A Receptor Antibody | Boster Immunoleader PB9599 product information

product summary

request information :

company name :

Boster Immunoleader

product type :

antibody

product name :

Anti-5HT2A Receptor Antibody

catalog :

PB9599

quantity :

100 ug/vial

price :

240 USD

clonality :

polyclonal

host :

rabbit

reactivity :

human, rat

application :

western blot

more info or order :

Boster Immunoleader product webpage

product information

Product Name :

Anti-5HT2A Receptor Antibody

Catalog Number :

PB9599

Clonality :

Polyclonal

Description short :

Rabbit IgG polyclonal antibody for 5-hydroxytryptamine receptor 2A(HTR2A) detection. Tested with WB in Human;Rat.

Price :

240 USD

Ig type :

Rabbit IgG

Size :

100 ug/vial

Form :

Lyophilized

Specificity :

No cross reactivity with other proteins.

Reactivity :

Reacts with: human, rat

Applications :

Western blot :

Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat

Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Storage :

At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.

Relevant detection systems :

Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.

Background :

The mammalian HTR2A (5-HT2A receptor) is a subtype of the 5-HT2 receptor that belongs to the serotonin receptor family and is a G protein-coupled receptor (GPCR). This is the main excitatory receptor subtype among the GPCRs for serotonin (5-HT), although 5-HT2A may also have an inhibitory effect on certain areas such as the visual cortex and the orbit frontal cortex. This receptor was given importance first as the target of psychedelic drugs like LSD. Later it came back to prominence because it was also found to be mediating, at least partly, the action of many antipsychotic drugs, especially the atypical ones.5-HT2A also happens to be a necessary receptor for the spread of the human polyoma virus called JC virus. Sparkes et al. (1991) concluded that the gene is located on 13q14-q21 in man and on chromosome 14 in the mouse.

Reference :

1. Cook EH, Fletcher KE, Wainwright M, Marks N, Yan SY, Leventhal BL (August 1994). "Primary structure of the human platelet serotonin 5-HT2 receptor: identity with frontal cortex serotonin 5-HT2A receptor". J. Neurochem. 63 (2): 465–9. 2. Elphick GF, Querbes W, Jordan JA, Gee GV, Eash S, Manley K, Dugan A, Stanifer M, Bhatnagar A, Kroeze WK, Roth BL, Atwood WJ (2004). "The human polyomavirus, JCV, uses serotonin receptors to infect cells". Science 306 (5700): 1380–3.

Gene Name :

HTR2A

Protein Name :

5-hydroxytryptamine receptor 2A

Gene Full Name :

5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled

Synonyms :

5 HT 2 antibody 5 HT 2A antibody 5 HT2 receptor antibody 5 HT2A antibody 5 hydroxytryptamine receptor 2A antibody 5-HT-2 antibody 5-HT-2A antibody 5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled antibody 5-hydroxytryptamine 2A receptor antibody 5-hydroxytryptamine receptor 2A antibody 5HT2A_HUMAN antibody HTR 2 antibody HTR 2A antibody HTR2 antibody HTR2, formerly antibody HTR2A antibody serotonin 5-HT-2 receptor, formerly antibody serotonin 5-HT-2A receptor antibody Serotonin receptor 2A antibody

Uniprot ID :

P28223

more info or order :

Boster Immunoleader product webpage