product summary
request information :
company name :
Boster Immunoleader
product type :
antibody
product name :
Anti-HNF1 beta Antibody
catalog :
PB9597
quantity :
100 ug/vial
price :
240 USD
clonality :
polyclonal
host :
rabbit
reactivity :
human, rat
application :
western blot
product information
Product Name :
Anti-HNF1 beta Antibody
Catalog Number :
PB9597
Clonality :
Polyclonal
Description short :
Rabbit IgG polyclonal antibody for Hepatocyte nuclear factor 1-beta(HNF1B) detection. Tested with WB in Human;Rat.
Price :
240 USD
Ig type :
Rabbit IgG
Size :
100 ug/vial
Form :
Lyophilized
Specificity :
No cross reactivity with other proteins.
Reactivity :
Reacts with: human, rat
Applications :
WB
Western blot :
Concentration: 0.1-0.5μg/ml; Tested Species: Human, Rat
Notes :
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human HNF1 beta (496-525aa AQQPFMAAVTQLQNSHMYAHKQEPPQYSHT), identical to the related mouse and rat sequences.
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Storage :
At -20˚C for one year. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for a longer time. Avoid repeated freezing and thawing.
Relevant detection systems :
Boster provides a series of assays reacted with primary antibodies. Antibody can be supported by chemiluminescence kit EK1002 in WB.
Background :
HNF1 homeobox B (hepatocyte nuclear factor 1 homeobox B), also known as HNF1B or transcription factor 2 (TCF2), is a human gene. It is a member of the homeodomain-containing superfamily of transcription factors. This gene is mapped to 17q12. The HNF1B protein is believed to form heterodimers with another liver-specific member of this transcription factor family, TCF1. HNF1B functions as both a classic transcriptional activator and as a bookmarking factor that marks target genes for rapid transcriptional reactivation after mitosis. HNF1B also can regulate renal tubulogenesis by controlling expression of SOC3. Mutation of HNF1B that disrupts normal function has been identified as the cause of MODY5 (Maturity-Onset of Diabetes, Type 5).
Reference :
1. Bach, I., Mattei, M.-G., Cereghini, S., Yaniv, M. Two members of an HNF1 homeoprotein family are expressed in human liver. Nucleic Acids Res. 19: 3553-3559, 1991. 2. "Entrez Gene: TCF2 transcription factor 2, hepatic; LF-B3; variant hepatic nuclear factor". 3. Verdeguer, F., Le Corre, S., Fischer, E., Callens, C., Garbay, S., Doyen, A., Igarashi, P., Terzi, F., Pontoglio, M. A mitotic transcriptional switch in polycystic kidney disease. (Letter) Nature Med. 16: 106-110, 2010.
Gene Name :
HNF1B
Protein Name :
Hepatocyte nuclear factor 1-beta
Gene Full Name :
HNF1 homeobox B
Synonyms :
FJHN antibody Hepatocyte nuclear factor 1 beta antibody Hepatocyte nuclear factor 1-beta antibody HNF 1B antibody HNF 2 antibody HNF-1-beta antibody HNF-1B antibody HNF1 beta antibody HNF1 homeobox B antibody HNF1B antibody HNF1beta antibody HNF2 antibody Homeoprotein LF B3 antibody Homeoprotein LFB3 antibody HPC11 antibody LF B3 antibody LFB3 antibody MODY 5 antibody MODY5 antibody TCF 2 antibody TCF 2 protein antibody TCF-2 antibody TCF2 antibody TCF2 protein antibody Transcription factor 2 antibody Transcription factor 2 hepatic antibody Variant hepatic nuclear factor 1 antibody Variant hepatic nuclear factor antibody VHNF 1 antibody vHNF1 antibody
Uniprot ID :
P35680
company information
Boster Immunoleader
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits